SecReT6
Protein ID: 568143117
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31140
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6807600..6808643 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDV9R4H9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-111, Aligned region: 20..320
Protein Sequence: 347 a.a.     [Download]
>gi|568143117|ref|YP_008935702.1| type VI secretion protein [Pseudomonas sp. TKP]
MESQARASSDPVSTLDAMHQEPWEYDFFQALRRIECESPELPRLGHSLRLADDPLRLGQQADCTFAPATL
ASVDPGGDGKPARLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKQFLDIFHHRLLSLFYRAWAEA
RPTVSHDRPDDDYWSARLAALSGRGMPSLLNQGLIPDTAKLHYSGHLSAQTRYPDGLKAILGEYFGLPVE
IEEYVGQWLELPERSRVGVSANQLGVDFCLGSHVWDRQHKFRIRLGPLKLDDYMGMLPGQSPFNELVAWV
AEYLGHELDWDLNLVLQQPEVPALQLNGQFRLGFNTWLGRPAVDANDLILARHYADQATTSRNPEHG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6807600-6808643 Pseudomonas sp. TKP, complete genome
ATGGAAAGCCAAGCCCGGGCGTCGTCCGACCCTGTGAGTACTTTGGATGCGATGCATCAGGAGCCCTGGG
AATACGATTTCTTCCAGGCATTGCGGCGTATCGAGTGCGAATCGCCCGAGCTGCCGCGCCTGGGCCATTC
CCTGCGCCTGGCGGATGACCCGCTGCGCCTGGGGCAGCAGGCCGATTGCACTTTCGCCCCGGCTACGCTG
GCCTCGGTCGATCCCGGTGGCGACGGCAAGCCGGCGCGGCTGGAGCAATTCTTCTTCGGCCTTGGCGGCC
CCAACGGCCCGCTGCCGCTGCATATCACCGAATACGTGCGCGAACGCCAGCGCAACAACGCCGACAGCAC
CAGCAAGCAGTTCCTGGATATCTTCCACCACCGCCTGCTGAGCCTATTCTACCGGGCCTGGGCCGAGGCA
CGGCCGACGGTCAGCCACGACCGCCCGGACGATGACTACTGGTCTGCACGCCTCGCCGCACTGAGTGGTC
GCGGGATGCCAAGCCTGCTGAATCAGGGGCTCATCCCTGATACCGCGAAGCTGCATTACAGCGGCCATCT
GTCGGCGCAAACCCGCTACCCGGACGGTTTGAAGGCGATCCTCGGCGAGTATTTCGGCCTGCCGGTGGAG
ATCGAAGAATACGTCGGCCAATGGCTGGAACTGCCCGAGCGCAGCCGCGTGGGCGTCAGCGCCAACCAAC
TGGGCGTGGACTTCTGCCTGGGCAGCCACGTGTGGGACCGCCAGCATAAATTCCGTATCCGCCTGGGCCC
ACTCAAGCTGGACGACTACATGGGCATGCTGCCTGGCCAGTCGCCGTTCAATGAGCTGGTGGCCTGGGTG
GCCGAGTACCTGGGCCATGAATTGGACTGGGACTTGAACCTGGTTTTGCAACAACCCGAAGTGCCGGCGC
TGCAACTCAACGGCCAGTTCCGCCTGGGCTTCAACACCTGGCTTGGCCGCCCTGCGGTTGATGCCAACGA
CCTAATCCTGGCCCGGCATTACGCCGATCAAGCCACCACCTCAAGGAATCCAGAGCATGGGTGA