SecReT6
Protein ID: 568143118
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31145
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6808636..6811290 [+]
ProductATPase AAA
NoteTssH
UniProt IDV9R5W2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-39, Aligned region: 615..781
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 233..367
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 6.80E-16, Aligned region: 788..862
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 507..507
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 590..665
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 233..252
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 350..363
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 620..734
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 212..246
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 619..738
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 232..314
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 357..398
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 618..641
AAA_22 [PF13401], Evalue: 1.30E-06, Aligned region: 682..702
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 228..310
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 618..645
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 233..249
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 614..660
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 211..249
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 284..317
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 620..641
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 687..702
NACHT [PF05729], Evalue: 0.0003, Aligned region: 233..333
NACHT [PF05729], Evalue: 0.0003, Aligned region: 621..647
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 233..254
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 618..642
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 233..250
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 622..648
AAA_18 [PF13238], Evalue: 0.00039, Aligned region: 808..851
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 216..254
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 620..648
Clp_N [PF02861], Evalue: 0.00056, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00056, Aligned region: 108..149
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 233..250
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 620..656
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 618..645
Torsin [PF06309], Evalue: 0.0021, Aligned region: 578..644
Protein Sequence: 884 a.a.     [Download]
>gi|568143118|ref|YP_008935703.1| ATPase AAA [Pseudomonas sp. TKP]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNVEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSSEFDK
IKAEALSERFDEYVGDSPENALSASDGFNAGVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDPI
VGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGAS
MKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYK
KHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDKS
VSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIAIGARQSNSEALLSAERERLATL
ESRWAEEKALVDELLATRATLREKAGVVDSGNDELRAKLVDLQQRLTALQGETPLILPTVDYQAVASVVA
DWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGK
TETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEK
AHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELISQVCKDPANIPEPEEIAKALRQPLLE
IFPPALLGRLVTIPYYPLSDEMLKAITRLQLNRIKKRVENTHKVAFDYDDAVVDLIVSRCTETESGGRMI
DTILTNSLLPDMSREFLTRMLEGKALAGVRISSRDNELHYQFND
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6808636-6811290 Pseudomonas sp. TKP, complete genome
ATGGGTGAAATCAGTCGCGCCGCGTTGTTCGGCAAACTCAACAGCGTGGCCTACAAGGCCATCGAAGCCG
CCACCGTGTTCTGCAAGCTGCGGGGCAACCCGTACGTGGAACTGGCCCACTGGTTTCACCAGTTGCTGCA
ACTGCAGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACGTGGAACCGGCACGCCTGGCCCGTGAC
CTCACCGAAGCCCTGGACCGCCTGCCGCGTGGTTCGACCTCGATCACCGACCTGTCTTCCCATGTGGAAG
AAGCCGTGGAGCGCGGCTGGGTCTATGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGGTTACCT
GGTGCTGGGCATCCTCAAGACCCCAAGCCTGCGCCATGCGTTGCTCGGCCTGTCGTCTGAGTTCGACAAG
ATCAAGGCCGAAGCCCTGAGCGAACGCTTTGACGAATACGTCGGCGACTCGCCGGAAAACGCCCTCAGCG
CCAGCGATGGTTTTAATGCCGGCGTTCCAGGCGAAGCCAGCGGTGCCATGGCGCCGAGTGCGATGGGCAA
GCAGGAGGCCCTCAAGCGTTTCACCGTCGACCTGACCGAGCAGGCACGCAGCGGCAAGCTCGATCCGATC
GTGGGCCGTGACGAAGAGATCCGCCAACTGGTGGACATCCTCATGCGTCGCCGCCAGAACAACCCGATCC
TCACCGGCGAAGCCGGCGTCGGCAAGACCGCCGTGGTCGAAGGTTTTGCCCTGCGCATCGTCGCCGGCGA
CGTGCCGCCCGCGCTGAAAGACGTGGAACTGCGCAGCCTCGACGTGGGCCTGCTGCAAGCCGGCGCCAGC
ATGAAAGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATTGAAGACGTCCAGGCCTCACCCAAGCCGATCA
TTCTGTTTATCGACGAAGCCCACACCCTCGTAGGTGCCGGTGGTGCCGCCGGGACCGGTGATGCCGCCAA
CCTGCTCAAGCCCGCCCTGGCCCGTGGCACCCTGCGTACCGTGGCCGCGACGACCTGGGCCGAGTACAAA
AAACACATCGAGAAAGACCCGGCCCTGACCCGTCGTTTCCAAGTGGTACAGGTGGCCGAGCCGTCGGAAG
ACAAGGCGCTGCTGATGATGCGCGGCGTGGCGTCGACCATGGAGAAACACCACCAGGTGCAGATCCTCGA
TGAAGCCCTGGAAGCCTCGGTGAAGCTGTCTCACCGCTACATCCCCGCGCGCCAGTTGCCGGACAAATCC
GTGAGCCTGCTGGACACCGCCTGCGCCCGCGTCGCCATCAGCCTGCACGCGGTGCCGGCCGAAGTGGACG
ACAGCCGTCGCCGCATCGAAGCCCTGGAAACCGAGCTGCAAATCATCGCCCGCGAGCATGCCATCGGCAT
TGCGATTGGCGCGCGCCAGAGCAACAGCGAAGCCTTGCTGAGCGCCGAGCGCGAGCGCCTGGCCACGTTG
GAAAGCCGCTGGGCCGAAGAGAAAGCGTTGGTGGATGAGTTGCTCGCCACCCGTGCAACCCTGCGCGAAA
AGGCCGGGGTTGTAGACAGTGGCAACGATGAGCTGCGTGCAAAACTGGTCGATCTGCAACAGCGCCTCAC
CGCGCTGCAAGGCGAAACCCCGTTGATCCTGCCGACCGTGGATTACCAGGCCGTGGCCTCGGTGGTCGCC
GACTGGACCGGTATCCCGGTGGGCCGCATGGCCCGCAACGAACTGGAAACCGTGCTCAACCTCGACCAGC
ACCTGAAAAAACGCATCATCGGCCAGGACCACGCCCTGCAGATGATCGCCAAGCGCATCCAGACCTCCCG
GGCCGGCCTCGATAACCCGAGCAAGCCGATCGGTGTGTTCATGCTGGCCGGCACCTCGGGCGTGGGCAAG
ACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTACGGCGGCGAGCAGAACGTGATCACCATCAACATGA
GCGAGTTCCAGGAAGCCCATACCGTGTCGACCCTCAAGGGTGCGCCACCGGGCTATATCGGCTACGGCGA
AGGCGGCGTGCTGACCGAAGCGGTGCGGCGCAAACCTTACAGCGTGGTCCTGCTGGACGAGGTGGAGAAA
GCCCACCCGGACGTGCATGAGATCTTCTTCCAAGTGTTCGACAAGGGCGTGATGGAAGACGGCGAAGGCC
GGGTGATCGACTTCAAGAACACCCTGATCCTGCTGACCACCAACGCCGGTACCGAGCTGATTTCCCAGGT
GTGCAAGGACCCGGCGAACATTCCCGAGCCGGAAGAAATCGCCAAGGCCCTGCGACAGCCGCTGCTGGAG
ATCTTCCCGCCAGCCTTGCTCGGCCGCCTGGTGACCATTCCTTACTACCCGCTCAGCGATGAGATGCTCA
AGGCGATCACCCGCCTGCAACTCAACCGCATCAAGAAGCGTGTGGAAAATACGCACAAGGTCGCCTTCGA
CTACGACGACGCGGTGGTCGACCTGATCGTCTCGCGCTGCACCGAAACCGAAAGCGGCGGGCGCATGATC
GACACCATCCTCACCAACAGCCTGCTGCCCGACATGAGCCGTGAATTCCTCACGCGCATGCTTGAGGGCA
AGGCGCTGGCGGGTGTGCGCATCAGCAGCCGGGATAATGAGCTGCACTACCAGTTCAACGATTGA