SecReT6
Protein ID: 568143119
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31150
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6811438..6813378 [+]
Producttype VI secretion protein ImpA
NoteTssI
UniProt IDV9R790
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-88, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0014, Aligned region: 514..536
Protein Sequence: 646 a.a.     [Download]
>gi|568143119|ref|YP_008935704.1| type VI secretion protein ImpA [Pseudomonas sp. TKP]
MLFNQASRLAKITSPLGPDVLLLNEMGGGEELGRLFTYELQLTSLDANIDLNQLLGKPMSVGLQLADGGE
RHFHGIVAQCSQSIDQGQFASYQVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQDRHVLVLADAYGAHTTVPGYASIPYYPKDEQQRER
DHMHNWHLAQQVQPGSLELNDYDFQRPSASIDVRSAMPRPHTAGDYPLYDYPGTYVQSADGEHYARTRIE
ALQTLHEQIEFSGNARGLGSGHLFSLTGFSRQDQNREYLIVGCRYYIVQESLESGGGSGAAQFESSLTCI
DAQQSFRPLASTHRPIVKGPQTALVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQSWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPENATQSGMKSRSSKGGTPANFNEIRM
EDKKGLEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVTIGNNRLRIVKQEDILSVGQRKTDSIS
QSYVIEVGENLRLVCGESILELNASGQINLTGVQISFYASGDAEFNTGGVLHLNNGGGPGATPDGQGQKG
AIDANIKAAFPAPKSS
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|568136993|ref|NC_023064.1|:6811438-6813378 Pseudomonas sp. TKP, complete genome
ATGCTATTCAACCAAGCCTCACGCCTGGCCAAGATCACCAGCCCCCTCGGGCCGGATGTGCTGCTGCTCA
ATGAAATGGGCGGCGGCGAAGAGCTGGGGCGCCTGTTCACCTACGAGCTGCAACTGACGTCCCTGGACGC
CAACATCGACCTCAACCAGTTGCTCGGCAAGCCGATGAGCGTGGGCCTGCAACTGGCGGACGGTGGCGAA
CGGCATTTCCACGGCATCGTCGCGCAGTGCAGCCAGAGCATCGACCAGGGCCAGTTCGCCAGCTACCAGG
TGACGCTACGCCCATGGCTGTGGCTGCTCAGCCGTACGTCCGATTGCCGGATTTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTCCGTGACCTGGGCTTTTCCGACTTCGAAGACGCCCTGAGCCGGCCG
TATCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGATTTCGTCAGCCGCCTGATGGAAC
AGGAAGGCATCTACTACTTCTTCCGCCATGAGCAGGACCGCCATGTGCTGGTGCTGGCCGATGCCTATGG
CGCCCACACCACGGTGCCGGGCTACGCGTCGATCCCCTACTACCCCAAGGACGAGCAGCAACGCGAACGC
GACCACATGCACAACTGGCACCTGGCGCAGCAAGTGCAGCCGGGCTCGCTGGAGCTCAACGACTACGACT
TCCAGCGCCCCAGCGCGAGCATCGACGTGCGCTCGGCCATGCCGCGCCCGCACACCGCGGGCGACTACCC
GCTGTACGACTACCCCGGCACCTACGTGCAAAGCGCAGACGGCGAACACTACGCACGTACCCGCATCGAA
GCCCTGCAAACCCTGCATGAGCAGATCGAGTTCAGCGGCAACGCCCGCGGCCTGGGCTCGGGCCACCTGT
TCAGCCTCACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATCGTCGGCTGCCGTTACTACAT
CGTCCAGGAAAGCCTGGAAAGCGGCGGCGGTTCAGGCGCGGCGCAGTTCGAAAGCAGCCTGACCTGCATC
GACGCCCAGCAAAGCTTCCGCCCACTGGCGAGCACCCACCGCCCGATCGTCAAAGGCCCTCAGACCGCGC
TGGTGGTGGGCCCCAAAGGCGAGGAAATCTGGACCGACCAGTACGGCCGCGTGAAGGTGCACTTCTACTG
GGACCGTCACGACCAATCCAACGAAAACAGCTCGTGCTGGATACGCGTCTCGCAATCCTGGGCCGGCAAG
AACTGGGGCTCGATGCAGATTCCACGCATCGGCCAGGAAGTGATTGTGAGCTTTCTGGAAGGTGATCCCG
ACCGGCCGATCATCACCGGGCGGGTGTACAACGCGGAGCAGACGGTGCCCTACGACCTGCCGGAAAATGC
GACCCAGAGCGGCATGAAGAGCCGCTCGAGCAAGGGCGGCACGCCGGCCAATTTCAATGAAATCCGCATG
GAGGACAAGAAGGGGTTGGAGCAGTTGTACATCCATGCCGAGCGTAACCAGGACATCGTCGTCGAAGTGG
ACGAAAGTCACTCGGTGGGGCATGACCGCAACAAGAGCATCGGGCACAACGAGACGGTGACCATCGGCAA
CAACCGCCTGCGCATCGTCAAGCAGGAAGACATCCTCTCGGTGGGCCAGAGGAAGACCGACAGCATCAGC
CAGAGCTACGTCATCGAAGTCGGTGAAAACCTGCGCCTGGTCTGCGGTGAAAGCATCCTGGAGCTCAACG
CCAGCGGGCAGATCAACCTGACTGGCGTGCAAATCAGTTTCTACGCCAGTGGCGATGCCGAGTTCAATAC
CGGCGGCGTGCTGCACCTGAACAACGGCGGCGGCCCCGGCGCCACGCCCGATGGCCAGGGCCAGAAAGGC
GCCATCGACGCCAATATCAAAGCCGCGTTTCCCGCGCCTAAAAGTTCCTGA