SecReT6
Protein ID: 568151260
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00385
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]86086..89184 [-]
Productserine/threonine protein kinase
NotePpkA
UniProt IDV9T1E3
KEGG IDpael:T223_00385
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.40E-52, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 7.20E-35, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 2.30E-13, Aligned region: 616..791
APH [PF01636], Evalue: 2.10E-05, Aligned region: 12..104
APH [PF01636], Evalue: 2.10E-05, Aligned region: 115..150
APH [PF01636], Evalue: 2.10E-05, Aligned region: 214..264
Kinase-like [PF14531], Evalue: 0.0002, Aligned region: 119..212
VWA [PF00092], Evalue: 0.00053, Aligned region: 616..772
Protein Sequence: 1032 a.a.     [Download]
>gi|568151260|ref|YP_008940205.1| serine/threonine protein kinase [Pseudomonas aeruginosa LES431]
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTLARLSHPNTVT
IHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPELGLVYVRQVAAALGYAHSQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKD
SLSTALAHLTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQG
SPRASNPPPAEPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGG
SRTPLIAAAAAAVLLAIGGGAWWLLSSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDGWLPASAVSDW
KQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLL
PIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYI
DRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATD
VSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYAL
HLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQS
LKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWL
SLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c89184-86086 Pseudomonas aeruginosa LES431, complete genome
ATGGACATAGAACTTCCGGGATTCGACATCGAACGCGAGCTGGGCGAAGGCGCCATGGCCACGGTCTACC
TGGCCACCCAGCGCTCGCTGCAGCGCAAGGTGGCGCTGAAGGTGATGGCCGCGGCGCTAGCCGCCGACCC
GAGCTTCGCCGAACGCTTCCTGCGCGAAGGTCGGACCCTGGCGCGGCTGTCGCACCCGAACACGGTGACC
ATCCACGACATCGGCAACGTCGGCAGTTGCTACTACATGGCCATGGAATACCTGCCCAACGGCACGCTCA
AGGAGCGCATCCAGCAGGGCCTCGATCCCGAGCTGGGCCTGGTCTACGTACGGCAGGTGGCCGCCGCGCT
CGGCTACGCGCACTCCCAGGGCCTGGTGCATCGAGACGTGAAGCCGGCCAATATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCGATCGAGGACAATACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACCCCCAGCTACATGAGCCCGGAGCAGGCCCGCGGGCAGGAGATCGACGGCCGCGC
CGACCTCTACGCGCTGGGCGTGGTGCTCTACGAGATCCTCACCGGCAAGCTGCCCTACAACGGCAAGGAT
TCGCTCTCCACCGCCCTGGCCCACCTCACCGAGCCGCTGCCGGAACTGCCGATCGAACAGGGCCGCTACC
AGGACATCCTGCGCCAGTTGCTGGCCAAGGACCCGGCCGAGCGCTTCCCAACCGCCGGCGCGCTGATCGC
CGCCCTCGACCGCCTGGCGCCGAGCGCCCTGGAAGCCACCCAGATCCGTCCGCTGGCGACGCCGCAGGGC
TCGCCGCGAGCGAGCAACCCGCCGCCGGCCGAACCCGCGCCCATGCCGCCCGCCGACCTCGGCGGCCTGC
AACCGGTATCGATCCAGTTGCCGCCGGTCACGCCCAGCGCCGGCGGCGCCACGCCGCCCCCGCCTCCGCC
ATCGCAAGCGGCGAAACCGCCATCGCCCCCGCCGCCTCCGCTGCCACCGGCGAAGCCGCGTGCCGGCGGC
AGCCGCACGCCGCTGATCGCCGCCGCCGCGGCCGCCGTGCTCCTGGCGATCGGCGGCGGCGCCTGGTGGC
TGCTGAGCTCGGGCGACGCGCCGAGCGCTGCCGATCCAGCGCCGCTGGGACAGACGCCGGCGGACAAGCC
GCAGCAGCAGACCCCGGTGGCCGATGCCGAACAGGACGGCGGCGAGCGTCCGCTGCTGATGCCAGGCAAG
AAGACCCTGTTCCAGCGCGTCCTGACCAAACCCGGCGCGGCCATCTCCGCCGAGGCTGGCGGCCCGCCCC
GGGCCGGCGCGGTGCCGGCCTTCTCGGTGCTCTACGTGTACGCCCGCAAGCAGGTCGGCGGCAGCCCCTG
GCTGCGCGTCGGCGCCTCCAGCAACGGAGAGGGCGACGGCTGGCTGCCGGCCAGCGCGGTGAGCGACTGG
AAGCAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGCCGCGCGCCGGTGATGTTCCTCAACAGCGCCG
AGCAGGTCGAGCGCCTGCTCGGCGATACCCGCGCAGCGCGCGACACCCTGACCCAGGCGGTGGATCACAA
GGGCGATCCGCAGGTGGTCGCGGTCGAGCCCAACGACCGGGCGATCCCCCAGGACCAGTTCTACCTGCTG
CCGATCTTCGACTCGAAGGAAAGCTTCGACGCCGACGGCCAGCCGGCGCAGTTGCTGGAGGTCGCCTCGA
TCGACCCCGGCGGCAGCGCCGCGGCACCCCAGGCGCCGGGCCAGGCCGGGCAGGGCGGCGCCAGCGGCGC
GGCGAGCGACACCTTCCGCACCGGCATCGTCCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATC
GACCGCGTGCGCGAGGTGATCGACGGCCTGCAGCGGCAGATCGGCGAGCGCGGCGACCTGGACAAGGTCA
GCTTCGGCCTGGTCGGTTTCCGCAACAACACCGACAAGACCCCCGGCCTGGAATACGTCAGCAAGACCCT
GGTGCCGCTGCAACCGGGCAACGACGCGCAGCGCTTCGCCGAGTTGAGCAGCCAGGTGCGCGCCACCGAC
GTCTCCAGCCACTCGTTCAACGAAGACGCCTTCGCCGGGATCATGCAGGCGGTCGACGAAATGGACTGGT
CGCCCTACGCCGGGCGCGTGGTGCTGCTGGTCACCGACGCCGGCGCGCTGCGCAAGAACGACCCGCTCGG
GCGCACCCAGATGAACGAGGCCGAGGTCCGCCAGGCGGCGCTGCGCAAGGGCGTGAAGATCTATGCCCTG
CACCTGCGCACCCCGGCCGGGAAGAACAACCACGGCTACGCCGAGCAGCAGTACCGCAGCCTCACCGCCG
ACGCCAACCCGAAGATCGCCGACCTCTACATCCCGGTGGCCGGCGGCGAGGTGAACGCCTTCGGCAACAC
GGTGAAGGAGATCGGCACGGTGTTCGCCGACCTAGTCCACGACGCCGGCAACCGCAAGCCGCAGGCGCCG
CGCTTCGACGCCGCGCCAAGCGTGGCGAGCAAGTCGGCGGCCATCGGCTACGCCATGCAGATGGAATTCC
TCGGTCGCCGCGACCCGGTGCGCGCGCCGCAGGTCGTCACCGCCTGGACCGCCGACCGTGACCTGACCAA
CCCGGCGCTGCCGGCGTTCCAGGTCTGCGTGCTGCTGAGCAAGCTGCAACTCAACGAACTGCAACAGTCG
CTGAAACTGATCGTCGACGCGGCCAAGCGCACCCAGACCTCGCCCAAGGACTTCTTCCAGGAAATCGCCA
GCGCCAGCGCCTACATGAGCCGCGACCCGGCGCAACTGGTGAAGGGCAGCAACCTGGCGCAGAGCGGCGT
GCTCGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTCTGGCTG
TCGCTGAGCGTCGCCGAACAGCAGGACTTCATCGACGAACTGGAGTCGAAGATCCGCCTCTACGAAACCT
TCCACAACGACGTCGCCAACTGGGTCCGGTTCGGCGACGCCGACGCCGGCGACGCGCTGTACCGCGTGCC
GCTGTCGACGCTGCCATGA