SecReT6
Protein ID: 568151261
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00390
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]89192..89920 [-]
ProductPppA
NotePppA
UniProt IDV9SY35
KEGG IDpael:T223_00390
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 6.40E-14, Aligned region: 20..209
PP2C [PF00481], Evalue: 1.70E-11, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 7.50E-08, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|568151261|ref|YP_008940206.1| PppA [Pseudomonas aeruginosa LES431]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPEAGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNALISEEEARHHPRANVVTRAVGVHEQLELSEATLHVLPGDSFLLCSDGLNKTADDSELRDVLS
HSDPYAVVRSLVHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c89920-89192 Pseudomonas aeruginosa LES431, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGGTCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAAGACGCCAGTCTCGACGCCCCCGAGGCGGGACTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGATACCCTGCGGCGTATCCCGGCGGCCTCCTCGCTACCG
GCCTATGTCGGCGCGTTGCGCACCGGCCTCGCCCAGGTCAACGAGCGGGTTCGCCAGGAGGCCGGCCTGC
GTGGCGTCAGCGTGATGGGCAGCACCCTGGTACTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAGCTGCTCGACAACGCATTGATCAGCGAGGAAGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCAACTGGAACTGTCGGAAGCCACGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCAGC
CACAGCGATCCCTATGCGGTGGTCCGCAGCCTGGTCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA