SecReT6
Protein ID: 568151266
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00415
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]96840..97304 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV9SY38
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|568151266|ref|YP_008940211.1| type VI secretion protein [Pseudomonas aeruginosa LES431]
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c97304-96840 Pseudomonas aeruginosa LES431, complete genome
ATGCAGAAACTGATCGTCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGTGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGTTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTCGACGTGCCGGGGCAACGCACCAGCCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA