SecReT6
Protein ID: 568151267
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00420
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]97349..98836 [-]
Productsignal peptide protein
NoteFha
UniProt IDV9T293
KEGG IDpael:T223_00420
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 495 a.a.     [Download]
>gi|568151267|ref|YP_008940212.1| signal peptide protein [Pseudomonas aeruginosa LES431]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRARAS
LKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAAI
RHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYEEHSA
RLRRS
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c98836-97349 Pseudomonas aeruginosa LES431, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCTGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGCCGGCAAGCGCCGCCGCGTCGGCCGGCGGCGACCTGC
TGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCGGCCGGCGCCGAAGCGCAGAT
GGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTGCTGCGCGCGCGGGCCAGC
CTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCAGAACAACCCGCTGAAGTTCGCGC
CGAACGTCGACGAGGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTTCATGGCGCCGGATCGCGC
GGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAGCTGGCGGTGATGGCCGGCGTGCAGGCCGCCATC
CGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCTTCGGCAAGCCGGCCGGGCTTTCCG
GCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCTGTACGCGAAGATCCTGCG
CGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCCTACGAGGAACACAGCGCT
CGACTACGGCGTTCCTGA