SecReT6
Protein ID: 568151269
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00430
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]100327..100845 [+]
Producthypothetical protein
NoteTssB
UniProt IDV9SZP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|568151269|ref|YP_008940214.1| hypothetical protein T223_00430 [Pseudomonas aeruginosa LES431]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDVDNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEEMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|568151185|ref|NC_023066.1|:100327-100845 Pseudomonas aeruginosa LES431, complete genome
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGTTGTACGGTGCCGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGGCCGACCTCGC
CGGCAAGCCCGCCGAACCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTC
GATGCCCGGCTGAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTACCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCAGTGGCGCGCAAGGTCGA
TTCGCTGAACAAGCTGCTCGAGGCGCGTACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGCGCCGAGGAAATGATCATGAAGGCGATCAAGGACCCGGCCCTGCTTCAGGCCCTGGCCAGCGCGCCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA