SecReT6
Protein ID: 568151272
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00445
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]103146..103931 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDV9T298
KEGG IDpael:T223_00445
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-43, Aligned region: 139..256
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 2..54
TPR_16 [PF13432], Evalue: 1.30E-07, Aligned region: 112..130
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 6..62
TPR_19 [PF14559], Evalue: 2.30E-05, Aligned region: 111..131
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 2..39
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 36..53
TPR_14 [PF13428], Evalue: 0.00021, Aligned region: 93..121
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 3..51
TPR_11 [PF13414], Evalue: 0.0037, Aligned region: 102..119
Protein Sequence: 261 a.a.     [Download]
>gi|568151272|ref|YP_008940217.1| virulence protein, SciE type [Pseudomonas aeruginosa LES431]
MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTY
STAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAP
FAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAE
TVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|568151185|ref|NC_023066.1|:103146-103931 Pseudomonas aeruginosa LES431, complete genome
ATGATCGCCGAAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGC
GCAGCCAGCCGTCGAACGCTACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGC
GCGGGCGCAGAACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTAC
TCCACCGCCATCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCG
GCCAGCCGGCGGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGACGCCGAAGGCCATGGCGAGGC
CGCCCAGGCCCTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAAGCGCCG
TTCGCCTGGCTGGCGGATGCCGACACGCGCCTCGGCCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATG
CCTGGTTGCCGATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGATCTGGTCTG
GCTGCCGGCCGAACTGACCCTGGCCAACGGTGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAA
ACCGTCGAGCACGGCGACGACGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGG
TCGGCCAGCGGCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAACTGGACTTCGA
GCCGACGGACGCCTGA