SecReT6
Protein ID: 568151276
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00465
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]107301..110009 [+]
ProductATPase AAA
NoteTssH
UniProt IDV9SY47
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-39, Aligned region: 236..251
AAA_2 [PF07724], Evalue: 4.10E-39, Aligned region: 631..797
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 234..367
AAA [PF00004], Evalue: 7.70E-19, Aligned region: 637..721
ClpB_D2-small [PF10431], Evalue: 1.10E-14, Aligned region: 804..878
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 498..548
AAA_16 [PF13191], Evalue: 1.00E-12, Aligned region: 606..681
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 357..364
AAA_5 [PF07728], Evalue: 2.10E-12, Aligned region: 636..751
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 57..98
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 345..404
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 634..657
AAA_22 [PF13401], Evalue: 2.00E-07, Aligned region: 698..718
Sigma54_activat [PF00158], Evalue: 6.30E-07, Aligned region: 213..248
Sigma54_activat [PF00158], Evalue: 6.30E-07, Aligned region: 635..759
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 285..388
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 636..657
Arch_ATPase [PF01637], Evalue: 1.20E-05, Aligned region: 707..718
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 630..676
AAA_25 [PF13481], Evalue: 4.90E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 4.90E-05, Aligned region: 487..507
AAA_25 [PF13481], Evalue: 4.90E-05, Aligned region: 535..556
AAA_25 [PF13481], Evalue: 4.90E-05, Aligned region: 634..661
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 636..664
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 531..566
AAA_18 [PF13238], Evalue: 0.00056, Aligned region: 638..664
Clp_N [PF02861], Evalue: 0.00069, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00069, Aligned region: 108..145
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00079, Aligned region: 634..658
NACHT [PF05729], Evalue: 0.0013, Aligned region: 234..261
NACHT [PF05729], Evalue: 0.0013, Aligned region: 637..663
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 634..661
AAA_17 [PF13207], Evalue: 0.0019, Aligned region: 234..248
AAA_17 [PF13207], Evalue: 0.0019, Aligned region: 503..503
AAA_17 [PF13207], Evalue: 0.0019, Aligned region: 636..672
Torsin [PF06309], Evalue: 0.0021, Aligned region: 593..660
Protein Sequence: 902 a.a.     [Download]
>gi|568151276|ref|YP_008940221.1| ATPase AAA [Pseudomonas aeruginosa LES431]
MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQILQLPDSDLHQIVRQSGIDPARLAKD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAK
LKVEALTERFDEYVGASPENGLSASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGA
SMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHHQVQILDEALEAAVRLSHRYIPARQLPDK
SVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELAIIRRESAIGVATAERQRNAETLLAEERERLSA
LEQRWAEEKRLVDELLETRARLRAAAEAVDAGGVPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEP
LILPTVDYQAVASVVADWTGIPVGRMARNEIETVLNLDRHLKKRIIGQDHALEMIAKRIQTSRAGLDNPS
KPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEA
VRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTEMIASLCADPELM
PEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVD
LIVSRCTETESGGRMIDAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFAEAE
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|568151185|ref|NC_023066.1|:107301-110009 Pseudomonas aeruginosa LES431, complete genome
ATGAGTGAGATCAGTCGCGTTGCGCTGTTCGGCAAGCTGAACAGCCTGGCCTACAAGGCCATCGAGGCCG
CCACGGTATTCTGCAAGCTGCGCGGCAATCCCTATGTCGAGCTGGTGCACTGGTTCCACCAGATCCTCCA
GTTGCCGGACTCGGACCTGCACCAGATCGTCCGCCAGTCCGGGATCGACCCGGCGCGCCTGGCCAAGGAC
CTGACCGAGGCCCTCGACCGCCTGCCGCGCGGCTCGACCTCGATCACCGACCTGTCCTCCCATGTCGAGG
AAGCGGTGGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAGAGCCAGGTGCGCACCGGCTACCT
GGTGATCGGCATCCTCAAGACGCCGAGCCTGCGCCATGCCCTCACCGGGCTGTCGGCGGAATTCGCCAAG
CTCAAGGTCGAGGCGCTCACCGAGCGCTTCGACGAGTACGTCGGCGCCTCGCCGGAGAACGGCCTGTCGG
CCAGCGACGGCTTCAACGCCGGCGCCGCCCCGGGCGAGGCCAGCGGCGCCCTGGCGCCGAGCGCGATGGG
CAAGCAGGAGGCGCTCAAGCGCTTTACCGTGGACCTCACCGAGCAGGCCCGTAGCGGCAAGCTCGACCCC
ATCGTCGGGCGTGACGAGGAGATCCGCCAGTTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACCGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTGGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTCCCGCCGGCGCTGAAGGACGTCGAACTGCGCGCCCTCGACGTCGGCCTGCTGCAGGCCGGGGCG
AGCATGAAGGGCGAGTTCGAGCAGCGCCTGCGCCAGGTGATCGAAGACGTGCAGAGTTCCGAGAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTCGGCGCCGGTGGCGCGGCCGGCACCGGCGACGCCGC
CAACCTGCTCAAGCCGGCCCTGGCGCGCGGTACCCTGCGCACCGTGGCGGCGACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAGGACCCGGCGCTGACCCGGCGTTTCCAGGTGGTGCAGGTGGACGAGCCGTCCG
AGCACAAGGCCATCCTGATGATGCGCGGCGTCGCGTCGACCATGGAGAAGCACCACCAGGTGCAGATCCT
CGACGAGGCGCTGGAGGCGGCGGTCCGGCTGTCGCACCGCTACATCCCGGCGCGCCAGCTGCCGGACAAG
TCGGTGAGCCTGCTGGATACCGCCTGCGCGCGCACCGCCATCAGCCTGCACGCGGTGCCGGCCGAGGTCG
ACGATAGCCGCCGGCGCATCGAGGCGCTGGAGACCGAGCTGGCGATCATCCGCCGCGAGAGCGCCATCGG
CGTCGCCACCGCCGAACGCCAGCGCAACGCCGAGACCCTGCTGGCCGAGGAGCGCGAGCGCCTGTCCGCC
CTGGAGCAGCGCTGGGCCGAGGAAAAACGCCTGGTCGACGAACTGCTGGAGACCCGCGCCCGTCTGCGTG
CCGCCGCCGAAGCGGTGGACGCCGGCGGCGTGCCGCTGGGCGAAGGCGAGGCGCGTCTCGACGAGGAACA
GCGCCAGGCGCTGCATGCGCGGCTGGCGGAGCTGCAGGCGCAACTGAGCGCGTTGCAGGGCGAAGAGCCG
CTGATCCTGCCGACCGTGGACTACCAGGCGGTGGCCTCGGTGGTCGCCGACTGGACCGGCATCCCGGTCG
GCCGCATGGCGCGCAACGAGATCGAGACCGTGCTCAACCTCGACCGGCACCTGAAGAAGCGCATCATCGG
CCAGGACCACGCGCTGGAGATGATCGCCAAGCGCATCCAGACTTCCCGCGCCGGCCTCGACAACCCGAGC
AAGCCGATCGGCGTGTTCATGCTCGCCGGCACCTCCGGGGTGGGCAAGACCGAGACCGCGCTGGCCTTGG
CCGAGGCCATGTACGGCGGCGAGCAGAATGTCATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACAC
CGTCTCCACCCTCAAGGGCGCCCCGCCCGGCTACATCGGCTACGGCGAGGGTGGCGTGCTGACCGAGGCG
GTGCGTCGCAAGCCCTACAGCGTGGTGCTGCTGGATGAAGTGGAGAAGGCCCACCCGGATGTCCACGAGA
TCTTCTTCCAGGTCTTCGACAAGGGCGTGATGGAGGACGGCGAAGGCCGGGTGATCGACTTCAAGAACAC
CCTGATCCTGCTCACCACCAACGCCGGCACCGAGATGATCGCCAGCCTCTGCGCCGATCCGGAACTGATG
CCCGAGCCGGAAGCCATCGCCAAGTCGCTGCGCGAACCGCTGCTGAAGATCTTCCCGCCGGCGCTGCTCG
GCCGCCTGGTGACCATCCCCTACTACCCGCTCAGCGACGACATGCTCAAGGCCATTTCGCGCCTGCAACT
GGGGCGGATCAAGAAGCGCGTGGAGGCGACCCACAAGGTGCCGTTCGAGTTCGACGAGGGCGTCGTCGAC
CTGATCGTCTCGCGCTGCACCGAGACCGAGAGCGGCGGCCGGATGATCGACGCGATCCTCACCAACACGC
TGTTGCCGGACATGAGCCGCGAGTTCCTCACCCGCATGCTCGAAGGCAAGCCGTTGGCCGGGGTACGTAT
CAGTAGCCGCGACAACCAGTTCCACTACGACTTCGCCGAGGCCGAGTGA