SecReT6
Protein ID: 568151278
SecReT6 ID887
T6SS typei3
Gene symbol-
Locus tagT223_00475
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]112102..112386 [-]
Producthypothetical protein
NoteTsi6 (i)
UniProt IDV9SYX1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|568151278|ref|YP_008940223.1| hypothetical protein T223_00475 [Pseudomonas aeruginosa LES431]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
 
Nucleotide Sequence: 285 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c112386-112102 Pseudomonas aeruginosa LES431, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCCGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAAGTCGATCTGC
CCTGA