SecReT6
Protein ID: 568154082
SecReT6 ID888
T6SS typei4a
Gene symbol-
Locus tagT223_15010
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3175338..3175763 [-]
Producttype VI secretion protein
NoteTssE
UniProt IDV9TAH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.50E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|568154082|ref|YP_008943060.1| type VI secretion protein [Pseudomonas aeruginosa LES431]
MSGALPPLFERLSAEADERPAFDDQALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c3175763-3175338 Pseudomonas aeruginosa LES431, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCAGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCAGCGGTCGAGCATTTCGAGCCGCGTCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGTAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA