SecReT6
Protein ID: 568154084
SecReT6 ID888
T6SS typei4a
Gene symbol-
Locus tagT223_15020
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3176347..3177831 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV9T7X6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-190, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|568154084|ref|YP_008943062.1| EvpB family type VI secretion protein [Pseudomonas aeruginosa LES431]
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDKDTVAMINDRI
SQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLTKIFESLELIKWRAFRESEDSRYVSLVLPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAA
WVLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISL
CHKKNSDVAVFFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c3177831-3176347 Pseudomonas aeruginosa LES431, complete genome
ATGCCCAAGTCATCCGCCGCCGAACAATCCGGCGAGAGTTCGACCCAGACCCTGTCCCTGCTCGACGAGA
TCATCGCAAAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTATGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTCCTCGACGAGGGCATGGCCGTCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGATGCGCTGATCAGCGACCAGCTCAACCAGATCATCCACCACCCCGAGTTGCAGAAGCTGG
AAGCCTCCTGGCGCGGCCTGCACCAACTGGTGAGCAACACCGAGACCAGCGCGCGGCTCAAGCTGCGCCT
GCTGAACGTCGGCAAGAACGAACTGCAGAACGACCTGGAGAAGGCGGTCGAGTTCGACCAGAGCGCACTG
TTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGACACCCCTTCAGCCTGCTGATCGGCGACT
TCACCTTCGGTCGCCATCCGCAGGACATCGGCCTGCTGGAGAAGCTGTCGAACGTCGCCGCGGCTGCCCA
CGCGCCGTTCATCGCCGCCGCCAGCCCACGCCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTACCG
CGCGACCTGACCAAGATCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGATT
CGCGCTACGTGTCCCTGGTGCTGCCGAACTTCCTCCTGCGCCTGCCCTACGGCCCGGAGACGCGCCCGGT
GGAAGGCATGAACTATGTCGAGGACGTCAACGGCACCGACCACTCCAAGTACCTCTGGGGCAACGCCGCC
TGGGTCCTGGCGCAGCGCATCACCGAGGCCTTCGCCAAGTACGGCTGGTGCGCGGCGATCCGCGGCGCGG
AAGGCGGCGGCGCGGTCGAGGGCCTGCCAGCGCACACGTTCCGCACCAGCTCCGGCGACCTGTCGCTGAA
ATGCCCGACCGAAGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGATCTCGGCTTCATTTCCCTG
TGCCACAAGAAGAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAGGCTCTACA
ACACCAACGAGGCCAACGCCAACGCGCGCCTGTCGGCGATGCTGCCGTACGTGCTGGCGGCATCGCGCTT
CGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTGAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCACCGCAGGAAATCAAGGCGCAGT
ACCCGCTGCGCGAGGCGCGGGTGGATGTCAGCGAGGTGGCCGGCAAACCGGGGGCCTACCGCGCCACGGT
GTTCCTCCGGCCGCACTTCCAGCTCGAGGAACTCAGCGCGTCGATCCGCCTGGTCGCCAACCTGCCGCCG
CCGGTAGCGGCGTGA