SecReT6
Protein ID: 568154087
SecReT6 ID888
T6SS typei4a
Gene symbol-
Locus tagT223_15035
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3179144..3180475 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDV9TAI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-69, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|568154087|ref|YP_008943065.1| type VI secretion protein [Pseudomonas aeruginosa LES431]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKA
LFLGGRLRLAQQAGNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|568151185|ref|NC_023066.1|:3179144-3180475 Pseudomonas aeruginosa LES431, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGACAGGCCTGCAACCCTTGGTTCTGGGGAGTGAC
CGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCAAGTGCGGGTCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGACGCGCCGCTGGAGTTCGATCTGGAGACAGCGC
TGGCGGCCGCCGAAGGGCCGTTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTATGTCAGCCTGCCCTACGTCCCGCCGACGCC
ACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCGGGCAACCAGGACGACGCGGTGGAAATCCGTC
GCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCGAAGGCCTGCTGGCAAGCCGTGCGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGTTGGAGC
GGGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTATTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGACCCGCACCTGCCGTTGCTCGCCCGGC
AACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTTGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG