SecReT6
Protein ID: 568154088
SecReT6 ID888
T6SS typei4a
Gene symbol-
Locus tagT223_15040
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3180493..3181251 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDV9T6R0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|568154088|ref|YP_008943066.1| type VI secretion system protein ImpK [Pseudomonas aeruginosa LES431]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|568151185|ref|NC_023066.1|:3180493-3181251 Pseudomonas aeruginosa LES431, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAACCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGGGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGTTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCCGCCGCTGCGCCGCCACGGCGTCTGCCGGTGCGCGCAGCGCTGCCGGACGGC
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCACGAAATGGCGGCCGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA