SecReT6
Protein ID: 568154809
SecReT6 ID889
T6SS typei1
Gene symbol-
Locus tagT223_18735
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]3998559..3999065 [-]
Producttype VI secretion protein
NoteTssJ
UniProt IDV9T9Z3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|568154809|ref|YP_008943793.1| type VI secretion protein [Pseudomonas aeruginosa LES431]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c3999065-3998559 Pseudomonas aeruginosa LES431, complete genome
ATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTGCTCGGCAAGG
CGGGTGACGCGCGATGA