SecReT6
Protein ID: 568154813
SecReT6 ID889
T6SS typei1
Gene symbol-
Locus tagT223_18755
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]4002033..4004660 [-]
ProductATPase AAA
NoteTssH
UniProt IDV9T8P5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-44, Aligned region: 206..284
AAA_2 [PF07724], Evalue: 7.60E-44, Aligned region: 609..774
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 208..339
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 614..737
AAA_5 [PF07728], Evalue: 1.80E-13, Aligned region: 208..230
AAA_5 [PF07728], Evalue: 1.80E-13, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 7.90E-13, Aligned region: 733..763
ClpB_D2-small [PF10431], Evalue: 7.90E-13, Aligned region: 785..854
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 612..718
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 9..95
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 186..230
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 584..649
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 2.40E-08, Aligned region: 761..840
AAA_17 [PF13207], Evalue: 6.00E-07, Aligned region: 208..277
AAA_17 [PF13207], Evalue: 6.00E-07, Aligned region: 612..648
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 208..235
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 613..652
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 28..73
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 102..122
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 203..225
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 613..732
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 208..345
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 612..695
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 208..231
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 614..650
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 201..225
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 611..638
IstB_IS21 [PF01695], Evalue: 0.00047, Aligned region: 202..227
IstB_IS21 [PF01695], Evalue: 0.00047, Aligned region: 455..477
IstB_IS21 [PF01695], Evalue: 0.00047, Aligned region: 613..631
AAA_19 [PF13245], Evalue: 0.0008, Aligned region: 205..233
AAA_19 [PF13245], Evalue: 0.0008, Aligned region: 353..384
AAA_19 [PF13245], Evalue: 0.0008, Aligned region: 480..509
AAA_19 [PF13245], Evalue: 0.0008, Aligned region: 611..635
DUF258 [PF03193], Evalue: 0.00081, Aligned region: 174..227
DUF258 [PF03193], Evalue: 0.00081, Aligned region: 612..625
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 208..234
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 256..288
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 613..648
AAA_25 [PF13481], Evalue: 0.0028, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.0028, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 0.0028, Aligned region: 610..642
AAA_23 [PF13476], Evalue: 0.0039, Aligned region: 208..224
AAA_23 [PF13476], Evalue: 0.0039, Aligned region: 440..490
AAA_23 [PF13476], Evalue: 0.0039, Aligned region: 611..639
Zeta_toxin [PF06414], Evalue: 0.0055, Aligned region: 206..229
Zeta_toxin [PF06414], Evalue: 0.0055, Aligned region: 612..653
SRP54 [PF00448], Evalue: 0.01, Aligned region: 208..229
SRP54 [PF00448], Evalue: 0.01, Aligned region: 612..634
Protein Sequence: 875 a.a.     [Download]
>gi|568154813|ref|YP_008943797.1| ATPase AAA [Pseudomonas aeruginosa LES431]
MINVDLQQLIQALDADTRRDLEGSAERCVARGGSKVLVEDLLLGLLERPQGLLARALQDAAVDAGELNAA
LQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLRNPLRYAGSRYQPLLARLDIE
RLKDFALSQPLEGAPSGKPGGGESLLQRFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLASRIAAGEVPPALRDVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAALRPTIL
FIDEAHTLIGAGGQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSVAE
AVTILRGLARVYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLERL
RGELAEGERQRQALRRDAEAGLPIDHDTLQALEERLAQAESERHVQEDQWSRQRELAERLLALRQQLARA
REANREEQGGEADAETFPADEHGGVEALEKALHETRQALADAQAQGRLVSFEVCPRLVAEVIGAWTGVPV
EQLAREHNAKVMGFADDLRARIRGQEQAVSALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALAL
ADLLYGGERFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVLN
LFYQIFDKGVANDGEGREIDFRNTLILMTSNLASEHIAALCQDGARPSAELLEETIRPALSRHFKPALLA
RMRVVPYYPVGGPVLRELIEIKLQRLGERLARRQLAFDYSQALVGHLAERCTQSDSGARLIDHLLDTHLL
PLVADRLLEAMARDERLERVHATLGEHGRVLCEFA
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c4004660-4002033 Pseudomonas aeruginosa LES431, complete genome
ATGATCAACGTAGACCTGCAACAACTGATTCAGGCGCTGGATGCCGACACCCGGCGCGACCTCGAAGGCT
CGGCCGAGCGCTGCGTAGCCCGTGGCGGCAGCAAGGTACTGGTGGAGGACCTGTTGCTGGGCCTGCTGGA
GCGTCCCCAGGGACTGCTGGCGCGCGCCCTGCAGGATGCCGCGGTGGACGCCGGCGAACTCAACGCCGCG
TTGCAAGCGCGGGGCGAGCACAGCGCCTCGCGCAATCCGGTGTTCGCGCCCGAGCTGGTGCAGTGGCTGC
AGGATGCGCTGTTGCTGGCCAACCTCGAACTGGGCCGTAGCCAGATCGACCAGGCGGCATTGATCCTGGC
CCTGCTACGCAACCCGTTGCGCTATGCCGGCAGCCGCTACCAGCCGCTGCTGGCGCGGCTCGACATCGAG
CGGTTGAAGGATTTCGCGCTCTCGCAGCCGCTGGAGGGCGCGCCCAGCGGCAAGCCGGGCGGCGGCGAGT
CCCTGTTGCAGCGTTTCACCCACAACCTTACCCAGCAGGCGCGCGACGGCAAGCTCGATCCGGTGCTCTG
TCGCGACGGGGCTATTCGCCAGATGGTCGACATCCTGGCCCGTCGGCGGAAAAACAACCCCATCGTGGTC
GGCGAGGCCGGCGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCCTCGCGGATCGCCGCAGGGGAAGTGC
CGCCGGCGCTGAGGGACGTCGAGCTGTTGTCCCTCGACATGGGCCTGTTGCAGGCCGGTGCCAGCGTGAA
GGGCGAGTTCGAGCGGCGCCTGAAAGGCGTCATCGACGAAGTGAAGGCAGCGCTCAGGCCGACCATCCTG
TTCATCGACGAGGCCCATACGCTGATCGGCGCGGGCGGTCAGGCCGGCGGCTCGGATGCCGCCAACCTGC
TCAAGCCGGCCCTGGCACGTGGCGAGTTGCGCACCATCGCGGCGACGACCTGGGCCGAATACAAGAAGTA
TTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTCCAGCCCGTGCAGTTGCATGAGCCGAGCGTTGCCGAG
GCGGTGACGATCCTGCGTGGCCTGGCCCGGGTTTACGAGGAAAGCCACGGTATCTACCTGCGCGACGACG
CGGTGGTGGCCGCCGCCGAACTGTCCGCCCGCTACCTGGCGGGTCGCCAGTTGCCGGACAAGGCCGTCGA
CGTCCTCGACACCGCCTGTGCGCGGGTGCGCATCAGCCTGGCGGCGGCGCCGGAGAGTCTCGAGCGCCTG
CGCGGCGAGCTGGCCGAAGGCGAGCGCCAGCGCCAGGCCCTGCGCCGCGATGCCGAGGCAGGCCTGCCGA
TCGACCACGATACCCTGCAGGCGCTGGAGGAGCGCCTGGCCCAGGCGGAAAGCGAGCGGCACGTACAGGA
GGACCAGTGGAGCCGCCAGCGCGAACTCGCCGAGCGCCTGCTCGCCCTGCGCCAGCAATTGGCCAGGGCC
CGCGAGGCGAACCGGGAAGAGCAGGGCGGCGAGGCGGACGCGGAGACTTTCCCGGCCGACGAGCATGGCG
GTGTCGAAGCCCTGGAAAAGGCCCTTCACGAAACCCGCCAGGCGCTCGCCGATGCCCAGGCCCAGGGGCG
GCTGGTCAGCTTCGAGGTCTGCCCGCGCCTGGTTGCCGAGGTGATCGGCGCCTGGACCGGCGTACCGGTG
GAACAACTGGCGCGGGAACACAACGCCAAGGTGATGGGGTTCGCCGACGACCTGCGGGCGCGGATCCGTG
GCCAGGAACAGGCGGTCAGCGCCCTGGACCGCGCGATGCGCGCCACCGCGGCCGGGCTGAACAAGCCCGA
TGCGCCGGTCGGCGTGTTCCTGCTGGTGGGCCCGAGCGGGGTGGGCAAGACCGAGACCGCGCTGGCGCTG
GCCGACCTGCTGTATGGCGGCGAGCGTTTCATCACCACCATCAACATGTCCGAGTTCCAGGAGAAGCACA
CCGTCTCGCGCCTGATCGGCGCGCCGCCCGGCTATGTCGGCTATGGCGAGGGTGGCATGCTCACCGAGGC
GGTACGCCAGAAGCCCTATTCGGTGATATTGCTGGACGAGGTGGAGAAGGCCGATCCGGACGTGCTCAAC
CTGTTCTACCAGATCTTCGACAAGGGCGTGGCCAACGATGGCGAAGGGCGCGAGATCGATTTCCGCAATA
CCTTGATCCTGATGACCTCCAACCTCGCCAGCGAGCACATCGCCGCGCTTTGCCAGGACGGCGCGCGGCC
TTCCGCCGAACTCCTGGAGGAAACCATCCGGCCGGCGCTCAGCCGGCATTTCAAGCCGGCGCTGCTGGCG
CGCATGCGCGTGGTGCCTTACTACCCGGTGGGCGGCCCGGTACTGCGCGAGCTGATCGAGATCAAGCTGC
AACGCCTCGGCGAGCGCCTGGCGCGCCGTCAACTGGCTTTCGACTACAGCCAGGCGCTGGTGGGCCACCT
GGCCGAGCGTTGCACCCAGAGCGACAGCGGCGCACGGTTGATCGACCACCTGCTGGACACGCACCTGCTG
CCGCTGGTGGCCGACCGTTTGCTGGAAGCGATGGCGCGCGACGAGCGTCTCGAGCGGGTCCATGCGACGC
TGGGCGAGCACGGCCGCGTGCTCTGCGAGTTCGCCTGA