SecReT6
Protein ID: 568154815
SecReT6 ID889
T6SS typei1
Gene symbol-
Locus tagT223_18765
StrainPseudomonas aeruginosa LES431
Repliconchromosome [GenBank: NC_023066] [Browse all T6SS(s) in this replicon]
Location [Strand]4005644..4007431 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV9TBF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|568154815|ref|YP_008943799.1| type VI secretion protein [Pseudomonas aeruginosa LES431]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYSV
TGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRALDGVAGK
PMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRG
LELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVT
GWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|568151185|ref|NC_023066.1|:c4007431-4005644 Pseudomonas aeruginosa LES431, complete genome
GTGTCCTTCAATCATTACTACCAGAGCGAACTCACCGCACTGCGCCAGCTGGGGCGCCGTTTCGCCGAGC
GTAGCCCGGCCCTGGCCCCGTTTCTCGGGCAGGTCGGACGCGATCCGGATGTCGAGCGCCTGCTCGAGGG
CTTTGCCTTCCTGACCGGGCGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCCTGA
CCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGTCGC
CTGTCGCTTCCGTACCTGCTACGCCACCGAAGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCGGTG
ACCGGCGAGGGTGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCATCTCGGCGAGCTGGGCC
TGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGCG
CAACCTGGAGAGCATCCAGCTGATTCCGCTAGACGCCCATGGGCGGGCGCTGGATGGCGTGGCCGGCAAG
CCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGGTTCGCCGAAGACGAGGCGTTGATTC
CCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAATACTTCGCGTTCCAGGACAAGTTCCT
GTTCGTCGACGTGGATGGCCTTGACCTGCTCGGCGCTCTGCCCGAGGAAACCCTCAAGCAGGTCCGCGGC
CTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCAAGC
TGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCAGGA
CGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAGGGCGTCACC
GGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCCTATGTGCCGTTCGAGTCCTTCGAGCACGATCCCAGCT
TCGACGTCCCGGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCTGGA
CACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGCACC
AACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCTTGCGAAGGTACGCCGGAGTTCC
TCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTGGAA
ACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCACTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA