SecReT6
Protein ID: 568182394
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13570
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2818342..2818881 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDV9ULN4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.00E-61, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|568182394|ref|YP_008955017.1| type VI secretion protein [Pseudomonas monteilii SB3078]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVYIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2818342-2818881 Pseudomonas monteilii SB3078, complete genome
ATGGCGAAGAAGGAAAGCACTCAGCACAAACTCGACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACG
ACGTGGACATCGGCGATGCCATCGAGAAAAAGGAGCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTTTC
CGGCAACCCGCTGGAGCCGCTGCCCAAACTCAAGGACCGCAAGTTCGTCTACATCGACCGCGACAACTTC
AACGGCGTGCTCAAGGGCATCAAGCCGCGCCTGACCTACCGCGTCGACAACACCCTGGCCAAGAACGGCA
CCCAGCTGGGCGTGGAACTGAACTTCAACAGCCTCGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGT
CGAACCGCTGCGCAAACTGCTGGAAGTGCGCAACAAGCTGGCCGACCTGCGTAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGCTGCTGATGGACGTGCTGCAGAACACCGAGAAGCTCAAGACCCTGGGCAAGGAAT
TCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAGCAGCGATCGCGCCTGA