SecReT6
Protein ID: 568182396
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13580
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2820425..2820907 [+]
Producttype VI secretion protein
NoteTssE
UniProt IDV9UMS8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|568182396|ref|YP_008955019.1| type VI secretion protein [Pseudomonas monteilii SB3078]
MSNQARLLPSLLDRLLDDRPYQSAEPAVQRTCSLSEYKASIVRDLEVLVNTRQSLVAEELEGYSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2820425-2820907 Pseudomonas monteilii SB3078, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCGTACCAGTCGG
CCGAGCCAGCCGTGCAACGCACCTGCTCGTTGAGCGAGTACAAGGCCAGCATCGTCCGTGACCTGGAGGT
ACTGGTGAACACTCGCCAGAGCCTGGTCGCCGAAGAGCTGGAGGGCTACAGCCAGCTCGGTGGTTCCATC
CTCGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCGCATGATCGGCGCCTGATCCAGC
AGCAACTGGAACGGGCGATCAGCACAGGGGACCGACGTTTTCGCCGTGTCCGCGTGCAGCTGCTGGCCCA
GCAGAACGGCCACCGTATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA