SecReT6
Protein ID: 568182397
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13585
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2820907..2822727 [+]
ProductImpG
NoteTssF
UniProt IDV9UJN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-211, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|568182397|ref|YP_008955020.1| ImpG [Pseudomonas monteilii SB3078]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGKHEKVTEAYRVARHTEMHANAVEGVVCKFRTCYPVELWPIAV
QQASFAELERSAFNGHSADLVARLRIRLAATGDALFGQMELDRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFQDQGRSREVALPADALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLNGFARILQGKA
IEQVEINFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCHPFFEPRGEQDPHSSFWVARRRIQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVY
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2820907-2822727 Pseudomonas monteilii SB3078, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAAATCGCTTCGCGGCTGTTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCACACTACCTGCGCCCTACCCCATCGATGTCGATTGCCG
AGCTGAGCCTGGGCAAGCACGAGAAAGTCACCGAAGCCTACCGGGTGGCGCGTCATACCGAGATGCATGC
CAATGCCGTGGAAGGTGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCGCCGAACTGGAGCGTTCGGCCTTCAACGGCCACAGCGCCGACCTGGTCGCACGCC
TGCGCATCCGCCTGGCAGCCACCGGCGATGCCCTGTTCGGGCAGATGGAACTGGACCGCCTGCGGTTCTT
CCTCGACGGCGAGGCGACCCTGATGCTGCAGTTGTACGAACTGCTGTTCAACAACCTGGCAAAGGCCACC
CTGAGCTTCCAGGACCAGGGCCGCAGCCGCGAAGTGGCCTTGCCGGCCGATGCCCTGAAAGCCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCGTTCCTGGGCTACCGCCTGCTGCACGAGTA
CTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTGAACGGCTTTGCCCGCATTCTGCAGGGCAAGGCC
ATCGAGCAGGTCGAGATCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACAC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACACCGATCATCAACCTGTTCCGCCAGCAAGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACTCCCGATACACGGCTGCACAACGCTGCC
GAAGTCGTCTCGATCGACCGCGTACGGCGGGTGCGCAAACTCGGCGGCATCGACCAGGTCGCCACCTGCC
ACCCGTTTTTCGAACCCCGTGGCGAGCAGGACCCGCACAGCAGCTTCTGGGTGGCGCGCCGGCGCATCCA
GGGTGACGCCACCGCCATGAGCATCCGCGTGGTCGACCGCGACCTGGAGCTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGATGTACCGCTGATGCTGCCGTTCGGGGGCGAACGTG
GTGACTTCAACATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCCTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATATGTCGCTG
GTCAGCCAGGGCCGTGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAGCCGGTGGTCGCACGCATCGGCCACCCGCGGCC
GAACTTCGTACGTGGCGTCGGCATCACGCTGACCCTGGATGAAAGCCAGTTCATCGGCAGTGGCGTGTAC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A