SecReT6
Protein ID: 568182398
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13590
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2822691..2823761 [+]
ProductImpH
NoteTssG
UniProt IDV9UKG4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|568182398|ref|YP_008955021.1| ImpH [Pseudomonas monteilii SB3078]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQQLKFEQQPTALRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVRQFAGRWLHLQPEQCTQLGRRNVQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQP
GTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2822691-2823761 Pseudomonas monteilii SB3078, complete genome
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGTACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGAC
CTGCACTTCGAGCGCGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCA
TGGGCCTGGTCGGGCCGTCAGGCGTACTGCCGCGCCCGTATACCGAGCTGCTGCTGGAGCGCCACGTGCA
GTATCGCGACGATGCCGCCCACGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAG
GCCTGGCAGAAGTACAAATTTCATATCGAGCACGAACGCAATGGCACTTCGGGCTTCGATGGCTACCTGC
TCAACCTGGTCGGCCTCGGCCCGCGCGCGCAGCAACTCAAGTTCGAGCAGCAACCAACCGCGCTGCGCCG
CGAGCTGTTCAGCTACTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAACGCGCTGAACCTCGAACGCATG
CTCGGCTTCTATTTCTCGCTGCCGATCAAGGTCCGCCAGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCG
AACAATGCACCCAGCTCGGCCGCCGCAATGTCCAGCTCGGCCACAGCGCCGTAGCCGGCAACCGGGTCTG
GGACTACCAGTCGTGCATCCGCATCGAGCTGGGCCCGCTAAGCCTGGCCGATTACCAGCGCTTCCAGCCG
GGCACCGCGTGCTACCGCAAGCTGGTGGAGCTGGTGCGCTTCTATATAGGCGCCGAACTGGATTTCGAAA
TTGCCCCGCGCCTCAAGCGCGAGGCGGTGCCACGCGCCCAGCTGGGCCGCAGTGGCAATGTCGCCCTGGG
CTGGCTGGGCTGGCTCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA