SecReT6
Protein ID: 568182400
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13600
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2826368..2827090 [+]
Producthypothetical protein
NoteTssJ
UniProt IDV9UI51
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-34, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|568182400|ref|YP_008955023.1| hypothetical protein X969_13600 [Pseudomonas monteilii SB3078]
MQHKHTALKRLTTAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPEKALGNTLVEAREITLLPGIGQIDQWPLAKSARYVGVAAFFRNEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKARDNAPTLTDKVQD
AVLDKASDAAGKSAQNTMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2826368-2827090 Pseudomonas monteilii SB3078, complete genome
ATGCAACACAAGCACACCGCCCTCAAACGCCTGACCACAGCGGCCTTGCTAGTGGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGATGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACCGACCTCGAACGCTTCGCCGCGACCGATGCCGAGACCCTGTGGGACACCC
CGGAAAAGGCCTTGGGCAACACCCTGGTGGAAGCCCGCGAGATCACCCTGCTGCCGGGCATCGGCCAGAT
CGACCAGTGGCCACTGGCCAAGAGCGCTCGCTACGTCGGCGTGGCAGCGTTCTTCCGCAACGAACAGGAC
GCGCGCTGGAAGGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCTTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTCGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTGGCAGCCGCGCAGAAGGCCCGGGACAACGCACCGACGCTCACCGACAAGGTGCAGGAC
GCCGTGCTCGACAAGGCCAGCGATGCCGCCGGCAAATCGGCACAGAACACCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA