SecReT6
Protein ID: 568182401
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13605
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2827087..2828430 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDV9UMT3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|568182401|ref|YP_008955024.1| type VI secretion protein [Pseudomonas monteilii SB3078]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRTTPFHWGVQVLQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVHAALKLPEPFGLNYVEDGQEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLARLTRNSMGGFNLDPHFVHPTLHLGSHETLAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLNQTKPSYWQGQLHDPRLTEADFYI
SVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGHVYER
MMNAQTICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2827087-2828430 Pseudomonas monteilii SB3078, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ATGAGTTCCACCAGCACCAGCTGGCCGAGGCGACCTTGCGCACCACCCCATTCCATTGGGGTGTGCAGGT
ACTGCAGGTGGATGAGGACGCCCTGGCCAACGGTTCGCTGCAGCTCAAGCGACTCAAGCTGGTGTTCCCT
GACGGCAGCCTTTACGACGCACCGCAGCACGACCCGTTGCCGGCTGCCCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTCAAGGTTCATGCTGCCTTGAAGCTGCCCGAGCCATTCGGCCTGAACTATGTCGAGGA
TGGCCAGGAACACAAGGCCGCGCGGCGTTTCCGCAAGCAGTTCGATACCCTGCCCGACCTCAATGAAGGC
GAGCTGGAAAACGAAATCACCAGCCTGCGCCTGAACGTGGTGCTGCTGGTGGACGGTGACAGCCTGGACG
GCTACAGCCACTGCCCGCTGGCCAGGCTGACCCGCAACAGCATGGGCGGTTTCAATCTCGACCCGCATTT
CGTCCACCCCACTCTGCATCTGGGCAGCCACGAGACCCTGGCCGGCATCGGCAAGCGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCCCTGTCCGGCCGACGCCGCGAACGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTAACCCTGTTCTGGCTGCTGAACACCGTCAACCGCGCCCACCCGCAGCTGGCCCATCTGCT
GGCGCACCCGCGCCTGCACCCCGAGCGCCTGTACCTGTTCCTTGCCGACCTGGCGGGTGGCCTGCTGACG
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAATACGACCATCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAGATGATCCGGGTGATGCTCGACAACGTGGTGCCCAACCAGTGCATCGTCATCAACCTCAA
CCAGACCAAGCCGTCGTACTGGCAGGGCCAGTTGCACGATCCACGCCTGACCGAGGCCGACTTCTATATC
TCGGTCCATGCCGACATGCCTGGTGCCAGCCTGCTGGAGCTGGTACCGCGGGCATTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTGGTCAACAGCGCGATGCCCGGCGTCACGCTCAACCATGCCGCACGGCTGCC
CAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCGCATGGCCATGTCTACGAGCGA
ATGATGAATGCCCAGACCATCTGCTTCTACGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA