SecReT6
Protein ID: 568182402
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13610
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2828427..2829143 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDV9UJN7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-54, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|568182402|ref|YP_008955025.1| type VI secretion system protein ImpK [Pseudomonas monteilii SB3078]
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVPAFEASVERFFANLERDARAANYSAEQ
VKDTQYALCAFLDESVLRASDNQLRQHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVC
VAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2828427-2829143 Pseudomonas monteilii SB3078, complete genome
ATGACCGAAGCCGTATTGCAACAGGGCGCCGTCGCGGCCGCCAACGACAAACCGACGCTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCCCTGATCGTGCGACGTGGTCGTCAGGTCACCTCGGTGCCGGCCTTCGA
AGCCAGCGTGGAACGCTTCTTCGCCAACCTGGAACGCGACGCCCGCGCAGCCAACTACAGCGCCGAACAG
GTCAAGGACACCCAGTACGCGCTGTGTGCCTTCCTCGACGAGAGCGTGCTGCGCGCGAGCGACAACCAGC
TGCGCCAGCACTTCGAGCTGCAGCCGCTGCAGTTCCGCTACTTCGGCGTGCACCTGGCGGGTGAAGGCTT
CTTCGAGAAGGTCGATGCGCTGCGTGCCGACGTCAAGCAGAACATCGATGTACTCGAGGTCTACCACCTG
TGCCTGGCCTTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAGAAAGACCAGCTGCGCTACCTGGCCAATA
CCCTGGGCCAGGATATTGCCCGCTACCGCAAGGCGCCCAAAGCACTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCACGAGGTGCCGCTGTGGGTTTACCTGGCGCTGATCGCGCTGGTCTGC
GTCGCCGTGTACCTGACGCTGGACTGGTTGCTGGACAAGGACGTCGCCGCCCTTTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA