SecReT6
Protein ID: 568182406
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13630
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2836518..2837036 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDV9UMT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|568182406|ref|YP_008955029.1| Hcp1 family type VI secretion system effector [Pseudomonas monteilii SB3078]
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQNGEDKAVSDLPVEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2836518-2837036 Pseudomonas monteilii SB3078, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTACTGGATGCAAAGCACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCCACCTCGGCTACCGCCAGCTCCTCGGGCGG
TGCGTCGTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGCAAGGCGGTCGACAAGGCTTCGGCCAAG
CTGTTCGAACACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTGAACCGCGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTGTCCTCGGTGCGCTTCATCGCCGGTGG
CAACCAGAACGGTGAAGACAAGGCTGTGAGCGACCTGCCCGTCGAAGAAATCAGCTTCAACTTCGCCCGC
ATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGCCAGGCTGGCGGCAACATCGTCGGCGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTGA