SecReT6
Protein ID: 568182420
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13700
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2853992..2854840 [+]
Producthypothetical protein
NoteTssL
UniProt IDV9UI72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-62, Aligned region: 59..265
Protein Sequence: 282 a.a.     [Download]
>gi|568182420|ref|YP_008955043.1| hypothetical protein X969_13700 [Pseudomonas monteilii SB3078]
MSDEPDVTVKTLHRKKKPVLLEDIQGNPLPRSSTESGQAMDLPGYSADPDFQLRGGFANLMLDAANPLFG
LVIRLRTLDDLPNIEQVHKTLQIQVSTIREEIQQHDYSSVHLEAYSYALCLYLDEAVMSRPWGNNSCWSH
EPLLSIFHGETQGGEKIFVLLERLMQSPEEFQDVLEFLYFCFCLGLKGKYALDPKCDEIINALISRMHKV
IRELRGPTPEFPGDPYTNVVHRPHRMRRREWPWWSPLVISAIAMVCAYCYYSYRLSLITAEVLESLNGIL
QQ
 
Nucleotide Sequence: 849 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2853992-2854840 Pseudomonas monteilii SB3078, complete genome
ATGTCCGATGAGCCCGATGTCACTGTGAAAACACTACACAGGAAGAAAAAGCCGGTCCTGCTGGAGGATA
TCCAAGGGAACCCGCTACCTCGCTCCAGCACCGAATCCGGGCAAGCCATGGATCTTCCTGGCTACTCAGC
CGACCCGGACTTCCAGCTACGCGGCGGCTTCGCCAACCTGATGCTCGACGCGGCCAACCCGCTGTTCGGC
CTGGTCATACGCCTGCGTACGCTGGATGACCTGCCCAACATCGAACAGGTGCACAAGACCCTGCAGATTC
AGGTCAGCACAATCCGCGAGGAAATACAGCAGCACGATTATTCCTCTGTGCACCTCGAAGCCTATTCCTA
TGCCTTGTGCCTTTACCTGGACGAGGCCGTGATGAGTCGGCCCTGGGGGAACAATTCGTGCTGGAGCCAC
GAACCGCTGCTCAGCATCTTCCATGGCGAAACCCAGGGTGGCGAGAAGATCTTCGTGTTGCTGGAGCGGT
TGATGCAGTCTCCGGAGGAGTTCCAGGATGTGCTGGAGTTCCTGTACTTCTGCTTTTGCCTGGGCCTGAA
GGGCAAGTACGCCCTGGACCCGAAGTGCGATGAAATCATCAACGCCCTGATTTCGCGGATGCACAAGGTC
ATTCGTGAACTGCGCGGCCCCACGCCGGAATTCCCGGGCGATCCCTATACCAACGTGGTCCATCGCCCCC
ACCGTATGCGGCGTCGGGAATGGCCCTGGTGGAGCCCGTTGGTGATCTCCGCCATCGCCATGGTCTGCGC
CTACTGCTACTACAGCTACCGCCTGAGCTTGATCACCGCCGAGGTGCTGGAGTCGCTCAACGGCATTTTG
CAGCAGTAG