SecReT6
Protein ID: 568185227
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13705
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2854855..2855712 [+]
Producthypothetical protein
NoteTssI
UniProt IDV9USV1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-39, Aligned region: 29..190
Protein Sequence: 285 a.a.     [Download]
>gi|568185227|ref|YP_008955044.1| hypothetical protein X969_13705 [Pseudomonas monteilii SB3078]
MPSQSDLRFTFQPLAGQIDFEVVSFELDEMISSPFQLKLELISFEDEVDFGQLLDKPVLFTIWRGERPLR
YVHGLVSSFSQGETGFYRTRYRALVEPVLARAGLRSNWRIFQQKTVPQILELMLRRQGIARFEINSMGEH
QVREFCVQAGETDLDFIARLAGEEGFVYRFEHTPKHHQLVITDRLLALGQISRSAIKADDEDEDFFDEDD
IGPDQVLYRANSGGDQAICTSCVSTTLQLCECWIHIVSCQGYSASKAKVVANFGTSGSSFAAIWKMAHMP
SPAPV
 
Nucleotide Sequence: 858 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2854855-2855712 Pseudomonas monteilii SB3078, complete genome
ATGCCTAGCCAATCCGACTTGCGCTTCACCTTCCAGCCGCTGGCTGGCCAGATTGACTTCGAGGTGGTTT
CGTTCGAACTCGACGAAATGATCAGCTCACCGTTCCAGCTGAAACTGGAATTGATCAGTTTTGAAGACGA
GGTCGACTTCGGCCAGTTGCTCGACAAACCAGTGCTGTTCACGATCTGGCGCGGTGAGCGCCCCCTGCGC
TATGTGCACGGCCTGGTCAGCAGTTTCAGCCAGGGTGAGACGGGGTTCTATCGCACCCGTTACCGCGCCT
TGGTCGAACCCGTGCTGGCCCGTGCCGGCTTGCGTTCGAACTGGCGCATCTTCCAGCAGAAGACCGTGCC
GCAGATTCTCGAATTGATGCTCAGGCGCCAGGGCATTGCCCGTTTCGAAATCAACAGCATGGGCGAGCAT
CAGGTGCGCGAGTTCTGCGTACAGGCCGGTGAAACGGACCTCGACTTCATCGCCCGCCTGGCGGGGGAAG
AGGGTTTCGTCTATCGCTTCGAGCACACGCCGAAACACCACCAGCTGGTCATCACCGACCGACTGCTGGC
GCTGGGACAGATCAGCAGGAGCGCGATCAAGGCCGACGACGAGGATGAAGACTTCTTCGACGAAGACGAC
ATTGGCCCCGACCAGGTGCTGTACCGCGCCAACAGCGGTGGCGACCAGGCCATTTGTACCTCCTGCGTTT
CCACAACGCTGCAGCTTTGCGAGTGCTGGATACATATCGTGAGCTGCCAGGGATACTCGGCAAGCAAGGC
CAAGGTGGTAGCGAACTTCGGGACGAGTGGGAGTTCATTCGCCGCTATATGGAAGATGGCCCACATGCCG
TCCCCCGCCCCCGTCTGA