SecReT6
Protein ID: 568187762
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13160
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2758054..2759910 [-]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDV9UYK4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-80, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 381..474
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 542..584
Gp5_C [PF06715], Evalue: 2.10E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 2.10E-06, Aligned region: 552..565
DUF2345 [PF10106], Evalue: 0.00047, Aligned region: 562..612
Protein Sequence: 618 a.a.     [Download]
>gi|568187762|ref|YP_008960375.1| type IV secretion protein Rhs [Pseudomonas monteilii SB3101]
MIMDLASALLSPQNRRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSI
EIELAEGGPRYITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVDIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNKQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPVEDRQFLLMSVESEGHNNYLTG
QQASYFNTFSCVRKKIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRTITVGGTHTETVKKDTMVQVTEGSYT
LQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|568185322|ref|NC_023076.1|:c2759910-2758054 Pseudomonas monteilii SB3101, complete genome
ATGATCATGGACCTGGCCTCCGCGCTGCTGTCGCCGCAGAACCGCCGCCTGTTCAAGTTTCACAACCTGG
CCAACCCCGAGCAGGAACTGCTGCTGGAAACCTTCAAGGGCACCGAAGCCCTGTCGCGGGCGTTCAACTA
CGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAAATCCATGATGGGCCAGCATGTCAGCATC
GAGATCGAACTGGCCGAAGGCGGCCCGCGCTACATAACCGGCTACCTCACACGCTTTGCCAGCATTGGCA
GCGACGGCGGCATGGCACGCTATACCGCAACCCTCAACCCGTGGTTCTCGATGTTGAAGAACCGCTTCGA
CACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTTACCGAAGTGTTCGCCCTGTGCCCGGCGTTC
TCTCGTCACGAGTTCCGCCTGACCCGTCCGCAGAAGCGCTACACCTACATCACCCAGTACCGTGAAACCG
ACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTACTACTTCGAGCACACCGCCGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGACATCCCCGAGCAACCGCAAATCCGCTTC
CACAGCGCCTCGGTCACCGAGACTGCCGACTCCATCACCCAGTGGAGCGGCAACCGCCAGTTGCAGTCCG
GCAAGATGGCCACGCAGACCTTCGACTACCGCCAGCCCAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAAGCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGCCAGTACACCCACGGCACCTAC
GACGAGGGCGAAACCCTGCTGCGCCTGCGCATCGAGGCGCTGGAGCTACGCGGCAAGAAATTCGAAGGTG
CCAGTAACTGTCGGGCCATGAAGCCGGGCTACACCTTCGAGCTGCTGCAGCACTACATCCACGACCAGGG
CCCGGTAGAAGACCGCCAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTTACCGGC
CAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAGCTGAGCA
CGCCCAAGCCGACCATCGCCGGCCCGCAGACCGCGATCATCGTCGGCCCACCGGGTGAGGAGATCTTCAC
CGACGAGCTGGGCCGGGTGAAGATCCAGTTCCACTGGGACCGCAATGGCAAGTACAACGACCACAGCTCG
TGCTGGGTACGCGTCGCCCAGTCCGGTGCCAGCGGCGGCTTCGGCAGCATCCAGATCCCACGTGTAGGCG
ACGAAGTGGTGGTGGTGTTCCTCGACGGCAACCCCGACCGGCCGCTGATCATGGGCAGCCTGTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCAGAGTGGTTTCCTGACCCGGTCGATGAAG
GGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAGGCTGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAGATCGAGTTGGATGAGACCCATGATGTGGGGAACAACCGCACGATTAC
GGTGGGCGGCACGCACACCGAAACGGTCAAGAAAGACACCATGGTGCAAGTGACCGAAGGTTCCTACACC
CTGCAGGTCGACAACCAGTTCATACAGGTGGCTGCCAAGCAGCACATCATCCTGCAGGTGGGCGACAGCA
GCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGGTCATCGTGACCACCAGCACCGACACCAC
CCAGATCACTGGCGCTGCAGTGCGGATCAACGACTGA