SecReT6
Protein ID: 568187772
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13215
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2768220..2768759 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDV9UYL0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.00E-61, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|568187772|ref|YP_008960385.1| type VI secretion protein [Pseudomonas monteilii SB3101]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVYIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2768220-2768759 Pseudomonas monteilii SB3101, complete genome
ATGGCGAAGAAGGAAAGCACTCAGCACAAACTCGACCGCGTTCGCGCGCCTCGGGTCCATATCACCTACG
ACGTGGACATCGGCGATGCCATCGAGAAAAAGGAGCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTTTC
CGGCAACCCGCTGGAGCCGCTGCCCAAACTCAAGGACCGCAAGTTCGTCTACATCGACCGCGACAACTTC
AACGGCGTGCTCAAGGGCATCAAGCCGCGCCTGACCTACCGCGTCGACAACACCCTGGCCAAGAACGGCA
CCCAGCTGGGCGTGGAACTGAACTTCAACAGCCTCGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGT
CGAACCGCTGCGCAAACTGCTGGAAGTGCGCAACAAGCTGGCCGACCTGCGTAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGCTGCTGATGGACGTGCTGCAGAACACCGAGAAGCTCAAGACCCTGGGCAAGGAAT
TCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAGCAGCGATCGCGCCTGA