SecReT6
Protein ID: 568187773
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13220
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2768774..2770276 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV9V372
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-197, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|568187773|ref|YP_008960386.1| EvpB family type VI secretion protein [Pseudomonas monteilii SB3101]
MTDKQTAPQQAGDLVEVENFAPQASLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASPELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2768774-2770276 Pseudomonas monteilii SB3101, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCGCCACAGG
CATCGTTGCTCGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAACTGGTGAACCAGGTGCTCGAGGGCGAGATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGTATCGCCGAAATCGACGCGATGCTTTCCGAGCAGATGAACGAAATCATGCACGCCC
GTGAGTTCCAGCAGCTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGCGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGCGCGCCTTTCG
GCATGCTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTGGAGGAGATCTCGCA
CGTCGCCGCGGCCGCCCATGCCCCGTTCATTTCGGCCGCCTCCCCCGAGCTGTTCGGCTGGGACTCGTTC
ACCGAAATGTCCGGCCCGCGTGACCTGGCAAAGATCTTCGACACCGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCGCGCTACGTCGGTCTCACCCTGCCGCACGTGCTCGGTCGCCTGCCGTATGG
CCCCGATACCACCCCGGTGGAGGAATTCAACTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCTGCCTACGCCCTCGGCACCCGCGTTACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGTGGCGGCCTGGTCGAAGGTTTGCCAACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCTCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAGCAGAAGCAGTACAACACTGACATTGCCAACGCCAACGCGCGCCTGTCGGCCCAGCTGCAGTACAT
CTTCGCCACTTCGCGCATCGCCCACTACATGAAGGCCATCATGCGCGACAAGATCGGCAGCTTCGCCTCG
CGCATGGATGTCGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTACGTGCTGCTCGACGACACCGCCAGCC
AGGAAGCCAAGGCCAAGTTCCCGCTGCGCGAAGCCCGCGCCGAGGTGTTCGAAGTGCCGGGCAAGCCAGG
TGTGTACAAGGCCGTGACCTACCTGCGCCCGCACTACCAACTGGATGAGCTGACCGCTTCGCTGCGCCTG
GTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA