SecReT6
Protein ID: 568187774
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13225
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2770303..2770785 [+]
Producttype VI secretion protein
NoteTssE
UniProt IDV9V068
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|568187774|ref|YP_008960387.1| type VI secretion protein [Pseudomonas monteilii SB3101]
MSNQARLLPSLLDRLLDDRPYQSAEPAVQRTCSLSEYKASIVRDLEVLVNTRQSLVAEELEGYSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2770303-2770785 Pseudomonas monteilii SB3101, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCGTACCAGTCGG
CCGAGCCAGCCGTGCAACGCACCTGCTCGTTGAGCGAGTACAAGGCCAGCATCGTCCGTGACCTGGAGGT
ACTGGTGAACACTCGCCAGAGCCTGGTCGCCGAAGAGCTGGAGGGCTACAGCCAGCTCGGTGGTTCCATC
CTCGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCGCATGATCGGCGCCTGATCCAGC
AGCAACTGGAACGGGCGATCAGCACAGGGGACCGACGTTTTCGCCGTGTCCGCGTGCAGCTGCTGGCCCA
GCAGAACGGCCACCGTATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCATTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA