SecReT6
Protein ID: 568187775
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13230
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2770785..2772605 [+]
ProductImpG
NoteTssF
UniProt IDV9V0X5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-211, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|568187775|ref|YP_008960388.1| ImpG [Pseudomonas monteilii SB3101]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGKHEKVTEAYRVARHTEMHANAVEGVVCKFRTCYPVELWPIAV
QQASFAELERSAFNGHSADLVARLRIRLAATGDALFGQMELDRLRFFLDGEATLMLQLYELLFNNLAKAT
LSFQDQGRSREVALPADALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLNGFARILQGKA
IEQVEINFYFSDYDLSERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGIDQVATCHPFFEPRGEQDPHSSFWVARRRIQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFVRGVGITLTLDESQFIGSGVY
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2770785-2772605 Pseudomonas monteilii SB3101, complete genome
ATGCTCGACGAACTGCTGCCCTACTACGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAAATCGCTTCGCGGCTGTTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTCGAGGTGCTGTACCCACACTACCTGCGCCCTACCCCATCGATGTCGATTGCCG
AGCTGAGCCTGGGCAAGCACGAGAAAGTCACCGAAGCCTACCGGGTGGCGCGTCATACCGAGATGCATGC
CAATGCCGTGGAAGGTGTGGTGTGCAAGTTCCGCACCTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAGCAGGCCTCGTTCGCCGAACTGGAGCGTTCGGCCTTCAACGGCCACAGCGCCGACCTGGTCGCACGCC
TGCGCATCCGCCTGGCAGCCACCGGCGATGCCCTGTTCGGGCAGATGGAACTGGACCGCCTGCGGTTCTT
CCTCGACGGCGAGGCGACCCTGATGCTGCAGTTGTACGAACTGCTGTTCAACAACCTGGCAAAGGCCACC
CTGAGCTTCCAGGACCAGGGCCGCAGCCGCGAAGTGGCCTTGCCGGCCGATGCCCTGAAAGCCGTGGGCT
ACGCCCGTGACGAAGGCCTGGTGGACTACTCCGAGCGCTCGTTCCTGGGCTACCGCCTGCTGCACGAGTA
CTTCACCTTCCCCGACAAGTTCATGTTCTTCGACCTGAACGGCTTTGCCCGCATTCTGCAGGGCAAGGCC
ATCGAGCAGGTCGAGATCAACTTCTATTTCTCCGACTACGACCTCAGCGAGCGCCTGGCGCGGCTGACAC
AGAACATCGGGCGCAACAACTTCAAGCTCAACTGCACACCGATCATCAACCTGTTCCGCCAGCAAGCCGA
GCCGATCAAGCTGACCCACACCCAGCACGAATACCCGGTCACTCCCGATACACGGCTGCACAACGCTGCC
GAAGTCGTCTCGATCGACCGCGTACGGCGGGTGCGCAAACTCGGCGGCATCGACCAGGTCGCCACCTGCC
ACCCGTTTTTCGAACCCCGTGGCGAGCAGGACCCGCACAGCAGCTTCTGGGTGGCGCGCCGGCGCATCCA
GGGTGACGCCACCGCCATGAGCATCCGCGTGGTCGACCGCGACCTGGAGCTGATCGACGCCAGCAGCGAC
ACCCTCAGCATCGGCCTTACCTGCAGCAACCGCGATGTACCGCTGATGCTGCCGTTCGGGGGCGAACGTG
GTGACTTCAACATTCCCGCCAACTCGGTGATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGTGTGCCCCTGGGCAAGGGCCTGATCTGGCGGTTGATCGCCCACCTGTCGCTGAACCATATGTCGCTG
GTCAGCCAGGGCCGTGAAGTGCTGCTGGAGCTGTTGTCGCTGTACAACTACCGCAATGTTTCCGCCATTC
GCAAACAGATCAACGGCATCAAGGCGATCAGCAGCGAGCCGGTGGTCGCACGCATCGGCCACCCGCGGCC
GAACTTCGTACGTGGCGTCGGCATCACGCTGACCCTGGATGAAAGCCAGTTCATCGGCAGTGGCGTGTAC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACCCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTG
A