SecReT6
Protein ID: 568187776
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13235
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2772569..2773639 [+]
ProductImpH
NoteTssG
UniProt IDV9V1V6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-103, Aligned region: 17..333
Protein Sequence: 356 a.a.     [Download]
>gi|568187776|ref|YP_008960389.1| ImpH [Pseudomonas monteilii SB3101]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSD
LHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYE
AWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQQLKFEQQPTALRRELFSYFAGLLSQKPRNALNLERM
LGFYFSLPIKVRQFAGRWLHLQPEQCTQLGRRNVQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQP
GTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIP
YDGVAL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2772569-2773639 Pseudomonas monteilii SB3101, complete genome
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCG
AATTCTTTCAATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGTACCGGGCGCATGGACCTGGCAACCCG
GCCGCACGAAGACCCGCTGCGTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGAC
CTGCACTTCGAGCGCGAAGGCAAGGTGTCGCCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCA
TGGGCCTGGTCGGGCCGTCAGGCGTACTGCCGCGCCCGTATACCGAGCTGCTGCTGGAGCGCCACGTGCA
GTATCGCGACGATGCCGCCCACGCGTTTCTCGACATCTTCTCGCACCGCATGACCACGCTGTTCTACGAG
GCCTGGCAGAAGTACAAATTTCATATCGAGCACGAACGCAATGGCACTTCGGGCTTCGATGGCTACCTGC
TCAACCTGGTCGGCCTCGGCCCGCGCGCGCAGCAACTCAAGTTCGAGCAGCAACCAACCGCGCTGCGCCG
CGAGCTGTTCAGCTACTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAACGCGCTGAACCTCGAACGCATG
CTCGGCTTCTATTTCTCGCTGCCGATCAAGGTCCGCCAGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCG
AACAATGCACCCAGCTCGGCCGCCGCAATGTCCAGCTCGGCCACAGCGCCGTAGCCGGCAACCGGGTCTG
GGACTACCAGTCGTGCATCCGCATCGAGCTGGGCCCGCTAAGCCTGGCCGATTACCAGCGCTTCCAGCCG
GGCACCGCGTGCTACCGCAAGCTGGTGGAGCTGGTGCGCTTCTATATAGGCGCCGAACTGGATTTCGAAA
TTGCCCCGCGCCTCAAGCGCGAGGCGGTGCCACGCGCCCAGCTGGGCCGCAGTGGCAATGTCGCCCTGGG
CTGGCTGGGCTGGCTCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTTCCACATTCCT
TACGATGGGGTCGCCTTGTGA