SecReT6
Protein ID: 568187778
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13245
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2776246..2776968 [+]
Producthypothetical protein
NoteTssJ
UniProt IDV9V376
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-34, Aligned region: 18..172
Protein Sequence: 240 a.a.     [Download]
>gi|568187778|ref|YP_008960391.1| hypothetical protein X970_13245 [Pseudomonas monteilii SB3101]
MQHKHTALKRLTTAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPEKALGNTLVEAREITLLPGIGQIDQWPLAKSARYVGVAAFFRNEQD
ARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKARDNAPTLTDKVQD
AVLDKASDAAGKSAQNTMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2776246-2776968 Pseudomonas monteilii SB3101, complete genome
ATGCAACACAAGCACACCGCCCTCAAACGCCTGACCACAGCGGCCTTGCTAGTGGCGCTGGCCGGCTGCG
GGGTCACCGACCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAA
GGTCATCCTGACCTCCGACGGCGGCAACCAGCTCAACCCCGATGCCGAGGGCAAGCCGCTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACCGACCTCGAACGCTTCGCCGCGACCGATGCCGAGACCCTGTGGGACACCC
CGGAAAAGGCCTTGGGCAACACCCTGGTGGAAGCCCGCGAGATCACCCTGCTGCCGGGCATCGGCCAGAT
CGACCAGTGGCCACTGGCCAAGAGCGCTCGCTACGTCGGCGTGGCAGCGTTCTTCCGCAACGAACAGGAC
GCGCGCTGGAAGGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCTTCCGACGGCC
TGCGGGTGCTGGTGGACAACACCGAAATCAGCGCCATGCGTGGCGTCGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTGGCAGCCGCGCAGAAGGCCCGGGACAACGCACCGACGCTCACCGACAAGGTGCAGGAC
GCCGTGCTCGACAAGGCCAGCGATGCCGCCGGCAAATCGGCACAGAACACCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA