SecReT6
Protein ID: 568187779
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13250
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2776965..2778308 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDV9V073
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-137, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|568187779|ref|YP_008960392.1| type VI secretion protein [Pseudomonas monteilii SB3101]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAEATLRTTPFHWGVQVLQVDEDALANGSLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVHAALKLPEPFGLNYVEDGQEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVLLVDGDSLDGYSHCPLARLTRNSMGGFNLDPHFVHPTLHLGSHETLAGIGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHHDPAASLVKLDEMIRVMLDNVVPNQCIVINLNQTKPSYWQGQLHDPRLTEADFYI
SVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGHVYER
MMNAQTICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2776965-2778308 Pseudomonas monteilii SB3101, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ATGAGTTCCACCAGCACCAGCTGGCCGAGGCGACCTTGCGCACCACCCCATTCCATTGGGGTGTGCAGGT
ACTGCAGGTGGATGAGGACGCCCTGGCCAACGGTTCGCTGCAGCTCAAGCGACTCAAGCTGGTGTTCCCT
GACGGCAGCCTTTACGACGCACCGCAGCACGACCCGTTGCCGGCTGCCCGCGACCTCAAGGACCTGCTCA
AGGCCAACGACCTCAAGGTTCATGCTGCCTTGAAGCTGCCCGAGCCATTCGGCCTGAACTATGTCGAGGA
TGGCCAGGAACACAAGGCCGCGCGGCGTTTCCGCAAGCAGTTCGATACCCTGCCCGACCTCAATGAAGGC
GAGCTGGAAAACGAAATCACCAGCCTGCGCCTGAACGTGGTGCTGCTGGTGGACGGTGACAGCCTGGACG
GCTACAGCCACTGCCCGCTGGCCAGGCTGACCCGCAACAGCATGGGCGGTTTCAATCTCGACCCGCATTT
CGTCCACCCCACTCTGCATCTGGGCAGCCACGAGACCCTGGCCGGCATCGGCAAGCGCCTGCTCGGCGCC
CTGCAGGCCAAGAGCAAGGCCCTGTCCGGCCGACGCCGCGAACGCGCCGACCAGATCGCCGAGTTCGGCT
CCAGCGACGTAACCCTGTTCTGGCTGCTGAACACCGTCAACCGCGCCCACCCGCAGCTGGCCCATCTGCT
GGCGCACCCGCGCCTGCACCCCGAGCGCCTGTACCTGTTCCTTGCCGACCTGGCGGGTGGCCTGCTGACG
TTCACCCTGGACACCCAGCTCAGCGACATCCCCGAATACGACCATCACGACCCGGCCGCGTCGCTGGTCA
AGCTCGACGAGATGATCCGGGTGATGCTCGACAACGTGGTGCCCAACCAGTGCATCGTCATCAACCTCAA
CCAGACCAAGCCGTCGTACTGGCAGGGCCAGTTGCACGATCCACGCCTGACCGAGGCCGACTTCTATATC
TCGGTCCATGCCGACATGCCTGGTGCCAGCCTGCTGGAGCTGGTACCGCGGGCATTCAAGGTCGGCTCGC
CGGAAGACATCGAGGTGGTGGTCAACAGCGCGATGCCCGGCGTCACGCTCAACCATGCCGCACGGCTGCC
CAACGCAATTCCGGTGCGCCTGGACAACCAGTACTTCGCCATCGAGCCGCATGGCCATGTCTACGAGCGA
ATGATGAATGCCCAGACCATCTGCTTCTACGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA