SecReT6
Protein ID: 568187785
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13280
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2787010..2788107 [+]
ProductImpA-like protein
NoteTssA
UniProt IDV9V0Y4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 200..214
ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 241..257
Protein Sequence: 365 a.a.     [Download]
>gi|568187785|ref|YP_008960398.1| ImpA-like protein [Pseudomonas monteilii SB3101]
MPEILNDLSLATLTAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVVNLSAQGL
AQQSKDLMLVAWLSEGLAQREHFEGITFGLRLTEQVLEAFWDTLYPTLEDGLDERAARLSWLKTTLTDIA
GGLPITQGQNFGVLRYDESRYVENLALQNPKAMQTALNEGKINAEIFQRSVALSDTEHLRTKALQIAASL
EACKALQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPATAAAAEPEATVAPTSEAGEPM
NTPVQATTPAPMRTTPLTRDEAFTMLAGIAQFFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNV
VDNIRDVLGTREPRS
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2787010-2788107 Pseudomonas monteilii SB3101, complete genome
ATGCCTGAAATCCTCAATGACCTTTCGCTGGCAACGCTGACCGCACCCATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCAGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACCTGAAGACCGCCGACTGGGAGCAGGTGGTCAACCTGTCGGCCCAAGGGCTG
GCGCAGCAAAGCAAGGACCTGATGCTGGTAGCCTGGCTCAGCGAAGGGTTGGCCCAGCGTGAACATTTCG
AAGGCATCACCTTTGGCCTTCGGCTGACCGAACAGGTACTGGAAGCATTCTGGGACACGCTGTACCCAAC
ACTCGAAGATGGCCTGGACGAACGCGCTGCGCGGCTGTCCTGGCTGAAGACCACGCTCACCGACATTGCC
GGTGGCTTGCCCATTACCCAAGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGCTACGTAGAAA
ACCTTGCCTTGCAGAACCCCAAGGCAATGCAGACCGCGCTGAACGAAGGCAAGATCAACGCCGAAATCTT
CCAGCGCTCGGTGGCGCTCAGCGACACCGAACACCTGCGCACCAAGGCCCTGCAGATCGCCGCCAGCCTG
GAGGCCTGCAAAGCCCTGCAAGCCAGTGCCGACCGCCTGTTCGGCCATGAGGCGCCCAGCTTTGCCAGCC
TTGCCGACATGCTGTCGCGCGCCAGCCAGCTGGCTGAAAAACTGCTCAAGGACCGCGGCGTCGAACTGCA
CCCCGCCACTGCGGCAGCGGCAGAGCCCGAAGCCACTGTTGCCCCCACCAGCGAAGCAGGTGAACCGATG
AACACACCCGTCCAGGCCACCACGCCTGCGCCGATGCGCACGACGCCACTGACCCGCGACGAAGCCTTCA
CCATGCTTGCGGGTATCGCCCAGTTCTTCAAGCAGAGCGAACCGCAAAGCCCGGTGCCCTACCTGATCGA
ACGCGCCATCAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTGAGCGATGTGATCAAGGACAGCAACGTG
GTGGACAACATTCGCGACGTGCTGGGCACCCGCGAGCCAAGATCCTGA