SecReT6
Protein ID: 568187798
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13345
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2803870..2804718 [+]
Producthypothetical protein
NoteTssL
UniProt IDV9V393
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-62, Aligned region: 59..265
Protein Sequence: 282 a.a.     [Download]
>gi|568187798|ref|YP_008960411.1| hypothetical protein X970_13345 [Pseudomonas monteilii SB3101]
MSDEPDVTVKTLHRKKKPVLLEDIQGNPLPRSSTESGQAMDLPGYSADPDFQLRGGFANLMLDAANPLFG
LVIRLRTLDDLPNIEQVHKTLQIQVSTIREEIQQHDYSSVHLEAYSYALCLYLDEAVMSRPWGNNSCWSH
EPLLSIFHGETQGGEKIFVLLERLMQSPEEFQDVLEFLYFCFCLGLKGKYALDPKCDEIINALISRMHKV
IRELRGPTPEFPGDPYTNVVHRPHRMRRREWPWWSPLVISAIAMVCAYCYYSYRLSLITAEVLESLNGIL
QQ
 
Nucleotide Sequence: 849 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2803870-2804718 Pseudomonas monteilii SB3101, complete genome
ATGTCCGATGAGCCCGATGTCACTGTGAAAACACTACACAGGAAGAAAAAGCCGGTCCTGCTGGAGGATA
TCCAAGGGAACCCGCTACCTCGCTCCAGCACCGAATCCGGGCAAGCCATGGATCTTCCTGGCTACTCAGC
CGACCCGGACTTCCAGCTACGCGGCGGCTTCGCCAACCTGATGCTCGACGCGGCCAACCCGCTGTTCGGC
CTGGTCATACGCCTGCGTACGCTGGATGACCTGCCCAACATCGAACAGGTGCACAAGACCCTGCAGATTC
AGGTCAGCACAATCCGCGAGGAAATACAGCAGCACGATTATTCCTCTGTGCACCTCGAAGCCTATTCCTA
TGCCTTGTGCCTTTACCTGGACGAGGCCGTGATGAGTCGGCCCTGGGGGAACAATTCGTGCTGGAGCCAC
GAACCGCTGCTCAGCATCTTCCATGGCGAAACCCAGGGTGGCGAGAAGATCTTCGTGTTGCTGGAGCGGT
TGATGCAGTCTCCGGAGGAGTTCCAGGATGTGCTGGAGTTCCTGTACTTCTGCTTTTGCCTGGGCCTGAA
GGGCAAGTACGCCCTGGACCCGAAGTGCGATGAAATCATCAACGCCCTGATTTCGCGGATGCACAAGGTC
ATTCGTGAACTGCGCGGCCCCACGCCGGAATTCCCGGGCGATCCCTATACCAACGTGGTCCATCGCCCCC
ACCGTATGCGGCGTCGGGAATGGCCCTGGTGGAGCCCGTTGGTGATCTCCGCCATCGCCATGGTCTGCGC
CTACTGCTACTACAGCTACCGCCTGAGCTTGATCACCGCCGAGGTGCTGGAGTCGCTCAACGGCATTTTG
CAGCAGTAG