SecReT6
Protein ID: 568306821
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0082
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]98431..99954 [-]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDV9TUC9
KEGG IDpaes:SCV20265_0082
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-15, Aligned region: 29..97
Protein Sequence: 507 a.a.     [Download]
>gi|568306821|ref|YP_008979090.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa SCV20265]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPRPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPQPQPQPQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLV
EGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAH
QLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
REFSRAYEEHSARLRRS
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c99954-98431 Pseudomonas aeruginosa SCV20265, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCGGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGC
CGGCAAGCGCCGCCGCGTCGGCCGGCGGCGACCTGCTGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCA
GTTGAAGGTCGACCCGGCCGGCGCCGAAGCGCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTG
GAAGGACTGGTGGACGTGCTGCGCGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGA
TCCAGCCGGTGCAGAACAACCCGCTGAAGTTCGCGCCGAACGTCGACGAGGCCATGCTGCTCCTGCTGCG
CCGCGACAACCAGGCGTTCATGGCGCCGGATCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCAC
CAGCTGGCGGTGATGGCCGGCGTGCAGGCCGCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGC
TGGAAGCCCGCTTCGGCAAGCCGGCCGGGCTTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTG
GGACAGTTTCACCGAGCTGTACGCGAAGATCCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGC
CGCGAATTCAGCCGCGCCTACGAGGAACACAGCGCTCGACTACGGCGTTCCTGA