SecReT6
Protein ID: 568306826
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0087
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]103560..104036 [+]
ProductUncharacterized protein ImpD
NoteTssD
UniProt IDV9TUD3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-46, Aligned region: 2..133
Protein Sequence: 158 a.a.     [Download]
>gi|568306826|ref|YP_008979095.1| Uncharacterized protein ImpD [Pseudomonas aeruginosa SCV20265]
MFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACS
SGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGA
KDGGPVKYGWNIRQNVQA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|568306739|ref|NC_023149.1|:103560-104036 Pseudomonas aeruginosa SCV20265, complete genome
ATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGGAAATCGACGTGC
TGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGGCGCCGGCAAGGT
CAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATGATGGCCTGCTCC
AGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACCAGGTCGAGTACC
TGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGGCGAGGATCGCCT
GACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAGGCGGATGGCGCG
AAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA