SecReT6
Protein ID: 568306828
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0089
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]105051..105560 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDV9TWZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|568306828|ref|YP_008979097.1| Uncharacterized protein ImpF [Pseudomonas aeruginosa SCV20265]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDHGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|568306739|ref|NC_023149.1|:105051-105560 Pseudomonas aeruginosa SCV20265, complete genome
ATGGCCGAACTGACCCTTCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAACCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCACGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCTACCTTCGAGCCGCGCATCATCCGTTCTTCGTTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGCGACCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA