SecReT6
Protein ID: 568306829
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0090
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]105557..107416 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDV9TTI2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-224, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|568306829|ref|YP_008979098.1| Protein ImpG/VasA [Pseudomonas aeruginosa SCV20265]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWP
LEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|568306739|ref|NC_023149.1|:105557-107416 Pseudomonas aeruginosa SCV20265, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAATTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAATTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGCTTCGCCTATCTCACCGCGCGGGTCCAGCTGAAGCTCGACGCGGAGTACCCGACC
TTCACCCACAACCTGTTGGAAATCGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AGTTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGCTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
CGGCCAGCTCGGCCCCGATGACCAGACCGCCTGCGAATACCGCACCGCCCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGCCCAGGCCGACTACTTCGGCAATCCCGCCGCGGTGCTCGGCCGCCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGCATCCCGTTCGACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGCGCCGACGAACAACCCTACCGCCTCTACGAACAATTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAATGCCTGGGTCGAACGCCTGCCGACGAGCAGCCTGC
GTGCGCGCGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGCCTGAACCGCGCCCTG
CGTCGATGCCACGGCGAGGAGCTGGAACTGGTCGTGCTGTTCGGCAAGCACGACCAGCGCCTGGAGGGCA
CGGTGGACGCGGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGCCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCATCACGTGATCGTCGACCGCACCCGTCCGCTGGATTTCGAG
GTGCATTCGCTGCAACAGGTGAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAACCGTTCTACGCGG
TGCGCGACCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCGCGCTCGACCTACGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAACCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAAGAGCGACTTCACCCTGGAGGACAGCGCGCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGCTGGCCGAGCGCGGCCAGGGCGCCGCCGCCCTGCGCGAGC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGCTGCAATTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCTTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGTGGCCTGGAGATCACC
CTGGACTTCGACGAGAACGCGTTCCGCGGCACCGGGGTGTTCCTTCTCGGCGCTGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA