SecReT6
Protein ID: 568306830
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0091
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]107380..108426 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDV9TY37
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|568306830|ref|YP_008979099.1| Uncharacterized protein ImpH/VasB [Pseudomonas aeruginosa SCV20265]
MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|568306739|ref|NC_023149.1|:107380-108426 Pseudomonas aeruginosa SCV20265, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAACCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTATGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGTCATTC
GGTGCGGCTGGCGGACGACCCGCTGCGTCTCGGGCAGAAGCCCGACTGCACCTTCGCGCCCTCGACCCTG
GCCTCGGTGAGCCAGGCCGGCACCGCTGCGGTGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGCC
CCAACGGGCCGCTGCCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGACGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCGGAGGCG
CGGCCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCGCGCCTCGCCGCGCTCTCCGGGC
GCGGCATGCCGAGCCTGCGGGGGCGCGAGCCGCTGGCGGATACCGCACGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAATACGTCGGCCAATGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGACCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAATACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCACGAAGTACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGACGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCACGAGCACAAGGAGAAGGAACATGAGTGA