SecReT6
Protein ID: 568306831
SecReT6 ID893
T6SS typei3
Gene symbol-
Locus tagSCV20265_0092
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]108419..111127 [+]
ProductClpB protein
NoteTssH
UniProt IDV9TUD6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 236..251
AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 631..797
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 234..367
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 637..754
ClpB_D2-small [PF10431], Evalue: 1.70E-14, Aligned region: 804..878
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 487..548
AAA_16 [PF13191], Evalue: 3.40E-12, Aligned region: 606..681
AAA_5 [PF07728], Evalue: 8.30E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 8.30E-12, Aligned region: 357..364
AAA_5 [PF07728], Evalue: 8.30E-12, Aligned region: 636..750
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 57..98
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 344..406
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 634..657
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 698..720
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 213..248
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 635..759
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 285..386
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 636..657
Arch_ATPase [PF01637], Evalue: 1.40E-05, Aligned region: 703..718
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 4.60E-05, Aligned region: 630..676
AAA_25 [PF13481], Evalue: 8.60E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 8.60E-05, Aligned region: 488..506
AAA_25 [PF13481], Evalue: 8.60E-05, Aligned region: 535..556
AAA_25 [PF13481], Evalue: 8.60E-05, Aligned region: 634..661
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 636..664
AAA_18 [PF13238], Evalue: 0.00042, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00042, Aligned region: 528..566
AAA_18 [PF13238], Evalue: 0.00042, Aligned region: 638..664
Clp_N [PF02861], Evalue: 0.00065, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00065, Aligned region: 108..145
AAA_19 [PF13245], Evalue: 0.00081, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00081, Aligned region: 634..658
NACHT [PF05729], Evalue: 0.0013, Aligned region: 234..261
NACHT [PF05729], Evalue: 0.0013, Aligned region: 637..663
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 634..661
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 234..248
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 502..502
AAA_17 [PF13207], Evalue: 0.0018, Aligned region: 636..672
Torsin [PF06309], Evalue: 0.0021, Aligned region: 593..660
Protein Sequence: 902 a.a.     [Download]
>gi|568306831|ref|YP_008979100.1| ClpB protein [Pseudomonas aeruginosa SCV20265]
MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQILQLPDSDLHQIVRQSGIDPARLAKD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAK
LKVEALTERFDEYVGASPENGLSASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGA
SMKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHHKVQILDEALEAAVRLSHRYIPARQLPDK
SVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELAIIRRESAIGVATAERQRNAETLLAEERERLAA
LEQRWAEEKRLVDELLETRARLRAAAEAVDAGGVPLGEDEARLDEEQRQALHARLAELQAQLSALQGEEP
LILPTVDYQAVASVVADWTGIPVGRMARNEIETVLNLDRHLKKRIIGQDHALEMIAKRIQTSRAGLDNPS
KPIGVFMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEA
VRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGLMEDGEGRVIDFKNTLILLTTNAGTEMIASLCADPELM
PEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAISRLQLGRIKKRVEATHKVPFEFDEGVVE
LIVSRCTETESGGRMIDAILTNTLLPDMSREFLTRMLEGKPLAGVRISSRDNQFHYDFAEAE
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|568306739|ref|NC_023149.1|:108419-111127 Pseudomonas aeruginosa SCV20265, complete genome
ATGAGTGAGATCAGTCGCGTTGCGCTGTTCGGCAAGCTGAACAGCCTGGCCTACAAGGCCATCGAGGCCG
CCACGGTATTCTGCAAGCTGCGCGGCAATCCCTATGTCGAGCTGGTGCACTGGTTCCACCAGATCCTCCA
GTTGCCGGACTCGGACCTGCACCAGATCGTCCGCCAGTCCGGGATCGACCCGGCGCGCCTGGCCAAGGAC
CTGACCGAGGCCCTCGACCGTCTGCCGCGCGGCTCGACCTCGATCACCGACCTGTCCTCCCATGTCGAGG
AAGCGGTGGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAGAGCCAGGTGCGCACCGGCTACCT
GGTGATCGGCATCCTCAAGACGCCGAGCTTGCGCCATGCCCTCACCGGGCTGTCGGCGGAATTCGCCAAG
CTCAAGGTCGAGGCGCTCACCGAGCGCTTCGACGAGTACGTCGGCGCCTCGCCGGAGAACGGCCTGTCGG
CCAGCGACGGCTTCAACGCCGGCGCCGCCCCGGGCGAGGCCAGCGGCGCCCTGGCGCCGAGCGCGATGGG
CAAGCAGGAGGCGCTCAAGCGCTTTACCGTGGACCTCACCGAGCAGGCCCGTAGCGGCAAGCTCGACCCC
ATCGTCGGGCGTGACGAGGAGATCCGCCAGTTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACCGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTGGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTCCCGCCGGCGCTGAAGGACGTCGAACTGCGCGCCCTCGACGTCGGCCTGCTGCAGGCCGGGGCG
AGCATGAAGGGCGAGTTCGAGCAGCGCCTGCGCCAGGTGATCGAAGACGTGCAGAGTTCCGAGAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTCGGCGCCGGTGGCGCGGCCGGAACCGGCGACGCCGC
CAACCTGCTCAAGCCGGCCCTGGCGCGCGGCACCCTGCGCACCGTGGCGGCGACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAGGACCCGGCGCTGACCCGGCGTTTCCAGGTGGTGCAGGTGGACGAGCCGTCCG
AGCACAAGGCCATCCTGATGATGCGCGGTGTCGCGTCGACCATGGAGAAGCACCACAAGGTGCAGATCCT
CGACGAGGCGCTGGAGGCGGCGGTCCGGCTGTCGCACCGCTACATCCCGGCGCGCCAGCTGCCGGACAAG
TCGGTGAGCCTGCTGGATACCGCCTGCGCGCGCACCGCCATCAGCCTGCACGCGGTGCCGGCCGAGGTCG
ACGATAGCCGCCGGCGCATCGAGGCGCTGGAAACCGAGCTGGCGATCATCCGCCGCGAGAGCGCCATCGG
CGTCGCCACCGCCGAACGCCAGCGCAACGCCGAGACCCTGCTGGCCGAGGAGCGCGAGCGCCTGGCCGCC
CTGGAGCAGCGCTGGGCCGAGGAAAAACGCCTGGTCGACGAACTGCTGGAGACCCGCGCCCGTCTGCGTG
CCGCCGCCGAAGCGGTGGACGCCGGCGGCGTGCCGCTGGGCGAAGACGAGGCGCGTCTCGACGAGGAACA
GCGCCAGGCGCTGCATGCGCGGCTGGCGGAGCTGCAGGCGCAACTGAGCGCGTTGCAGGGCGAAGAGCCG
CTGATCCTGCCGACCGTGGACTACCAGGCGGTGGCCTCGGTGGTCGCCGACTGGACCGGCATCCCGGTCG
GCCGCATGGCGCGCAACGAGATCGAGACCGTGCTCAACCTCGACCGGCACCTGAAGAAGCGCATCATCGG
CCAGGACCACGCGCTGGAGATGATCGCCAAGCGCATCCAGACTTCCCGCGCCGGCCTCGACAACCCGAGC
AAGCCGATCGGCGTGTTCATGCTCGCCGGCACCTCCGGGGTGGGCAAGACCGAGACCGCGCTGGCCTTGG
CCGAGGCCATGTACGGCGGCGAGCAGAATGTCATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACAC
CGTCTCCACCCTCAAGGGCGCCCCGCCCGGCTACATCGGCTACGGCGAGGGTGGCGTGCTGACCGAGGCG
GTGCGTCGCAAGCCCTACAGCGTGGTGCTGCTGGATGAAGTGGAGAAGGCCCACCCGGATGTCCACGAGA
TCTTCTTCCAGGTCTTCGACAAGGGCTTGATGGAGGACGGCGAAGGCCGGGTGATCGACTTCAAGAACAC
CCTGATCCTGCTCACCACCAACGCCGGCACCGAGATGATCGCCAGCCTCTGCGCCGATCCGGAACTGATG
CCCGAGCCGGAAGCCATCGCCAAGTCGCTGCGCGAACCGCTGCTGAAGATCTTCCCGCCGGCGCTGCTCG
GCCGCCTGGTGACCATCCCCTACTACCCGCTCAGCGACGACATGCTCAAGGCCATTTCGCGCCTGCAACT
GGGGCGGATCAAGAAGCGCGTGGAGGCGACCCACAAGGTGCCGTTCGAGTTCGACGAGGGCGTCGTCGAG
CTGATCGTCTCGCGCTGCACCGAGACCGAGAGCGGCGGCCGGATGATCGACGCGATCCTCACCAACACGC
TGTTGCCGGACATGAGCCGCGAGTTCCTCACCCGCATGCTCGAAGGCAAGCCGTTGGCCGGGGTACGTAT
CAGTAGCCGCGACAACCAGTTCCACTACGACTTCGCCGAGGCCGAGTGA