SecReT6
Protein ID: 568309684
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2945
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3125735..3127630 [-]
ProductVgrG protein
NoteTssI
UniProt IDV9U1F2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-68, Aligned region: 13..285
Phage_base_V [PF04717], Evalue: 1.50E-22, Aligned region: 314..407
Gp5_C [PF06715], Evalue: 1.10E-15, Aligned region: 464..486
Gp5_C [PF06715], Evalue: 1.10E-15, Aligned region: 499..520
Gp5_C [PF06715], Evalue: 1.10E-15, Aligned region: 523..546
Gp5_C [PF06715], Evalue: 1.10E-15, Aligned region: 604..617
Protein Sequence: 631 a.a.     [Download]
>gi|568309684|ref|YP_008981953.1| VgrG protein [Pseudomonas aeruginosa SCV20265]
MSLQGNSSTSLTLSNTVASHLSATLHNDSQQRPLDALVAEIHQLPADATADRFQLVLRPWLWWLTLASNN
RVFQNLATSDIVTTIFKAHGFTDFKLSLTGSYEPREYCVQYGETDFAFVSRLLEEEGIFWFFIHEVGKHT
LVLADSNDAFPPIPNGPKVPYLDQEIGVRELHGIRSAQYCLQAVAGTYSATDYEFTTPSTSLYSQAQAEA
GPRARYEHPGGYTAKGRGDALTKQRVDGLRSQEKRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSV
THDASHAHYRNRFEAIPKATAYRPARVTPKPRMHTQTALVVGKAGEEIWTDQYGRIKLQFPWDRDGKNDE
TSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTFIDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTN
SSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVNVLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKG
KRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGGNYSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLK
SDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKAGTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKV
N
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3127630-3125735 Pseudomonas aeruginosa SCV20265, complete genome
ATGTCTCTCCAGGGCAACAGCTCCACGTCGCTGACACTATCCAACACCGTCGCCTCGCACCTCAGCGCCA
CCCTGCACAACGACTCCCAGCAACGCCCCCTCGACGCCCTGGTCGCCGAAATCCACCAGCTCCCCGCCGA
CGCAACTGCCGACCGTTTTCAACTCGTACTCAGACCATGGCTCTGGTGGCTGACCCTGGCCAGCAACAAC
CGCGTGTTCCAGAACCTCGCCACCAGCGACATCGTCACCACGATCTTCAAGGCCCACGGCTTCACCGACT
TCAAGCTGTCGCTGACCGGCAGCTACGAGCCCCGTGAATACTGCGTGCAGTACGGCGAGACCGACTTCGC
CTTCGTCTCGCGCCTGCTGGAGGAGGAAGGCATCTTCTGGTTCTTCATCCACGAAGTGGGCAAGCACACG
TTGGTGCTGGCGGACAGCAACGACGCCTTCCCGCCGATCCCCAACGGGCCCAAGGTGCCATACCTGGACC
AGGAGATCGGCGTGCGCGAACTGCACGGCATCCGTTCGGCGCAGTACTGCCTGCAGGCGGTCGCCGGGAC
CTACAGCGCCACCGACTACGAGTTCACCACACCCAGTACTTCGCTCTATTCCCAGGCACAGGCCGAGGCC
GGGCCGCGCGCACGGTACGAACACCCCGGCGGCTACACCGCCAAGGGCCGCGGCGATGCGCTGACCAAGC
AGCGCGTGGACGGCCTGCGCAGCCAGGAAAAGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCC
CGGCCACTGGTTCACCCTCAGCGGGCATGACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTC
ACCCATGACGCCAGTCACGCGCACTACCGCAACCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCC
CCGCGCGGGTCACGCCCAAGCCGCGCATGCACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGA
GATCTGGACCGACCAGTACGGCCGGATCAAGCTCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAG
ACCTCGTCGTGCTGGGTGCGCGTGGTGCTGCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGC
GCATCGGCCAGGAAGTGATCGTCACCTTCATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGT
CTACAACGGCGACAACGCCCTGCCCTACGCGCTGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAAC
TCGTCGAAGGGCGGCGGCGGTTTCAACGAGCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAGGTCTTCC
TCCAGGCGCAGAAGGACCTCAACGTCAACGTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGAC
CCTGACGGTGCAGAACGCACGCACCCGCACGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGC
AAGCGCACGGTGACCATCCAGACCGGCAGCGACAGCCTGGATGTGAAGGACACGCGCACGGTGACGGTGG
GCGCCGACCAGACCCACAGCACCGGCGGCAACTACAGCCACAAGGTCAGCGGCAACTTCGAGCTGACGGT
GGACGGCAACCTGACCATCAAGGTCAGCGGCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAG
AGCGACGCCGACCTCGCCGCCCAGGCTGGCACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACC
AGGCCGGCACCTCCCTCACCAACAAGGCCGGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAA
CAAGGCCGGCGCCGAACAGACGGTGGACGGCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTC
AACTGA