SecReT6
Protein ID: 568309688
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2949
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3133097..3134890 [-]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDV9U540
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-181, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|568309688|ref|YP_008981957.1| Protein ImpG/VasA [Pseudomonas aeruginosa SCV20265]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGNLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEATLLGGEEAQALTGVGAARSALRLSLRCLGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
TVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVPAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTALGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGPRALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3134890-3133097 Pseudomonas aeruginosa SCV20265, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTACGGCACGCCG
GCGGCGCCTTCGCCGAGCGCTATCCGAAGGTCGCCCGGCGCCTGCAACTGGCTCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGTCTGCTGGAAGGTTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCAGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAGCCGGACCCGACCCAGGGCAACCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGTGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACCCTG
TGGCCGCTGGCGATCGACGAGGCGACCCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGGCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCCTGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
ACCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCACTGTCCGGCGCGCTCGCCGACGGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACCTCTTTCCGCGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTGGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTGGCCGGGAGCACCGTGCAGCCAGTCCCGGCCTACTATGGCTGCCGCCACGACAGCCACCTCG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGACCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTACGCGAAGCCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCGCGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAGTCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTGTCGCTGGTGGAAGGCCCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTAGCCCTGCACAACCTGCGCGACGATGCCAGCGCCCGCCGGCAGATAGAAGGGCTGAGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
AATCCGCCTGCGACTCGATCCGCAACACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGCTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA