SecReT6
Protein ID: 568309691
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2952
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3135883..3137367 [-]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDV9U2H4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-190, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|568309691|ref|YP_008981960.1| Uncharacterized protein ImpC [Pseudomonas aeruginosa SCV20265]
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDKDTVAMINDRI
SQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGHPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLTKIFESLELIKWRAFRESEDSRYVSLVLPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAA
WVLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISL
CHKKNSDVAVFFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3137367-3135883 Pseudomonas aeruginosa SCV20265, complete genome
ATGCCCAAGTCATCCGCCGCCGAACAATCCGGCGAGAGTTCGACCCAGACCCTGTCCCTGCTCGACGAGA
TCATCGCCAAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTATGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTCCTCGACGAGGGCATGGCCGTCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGATGCGCTGATCAGCGACCAGCTCAACCAGATCATCCACCACCCCGAGTTGCAGAAGCTGG
AAGCCTCCTGGCGCGGCCTGCACCAACTGGTGAGCAACACCGAGACCAGCGCGCGGCTCAAGCTGCGCCT
GCTGAACGTCGGCAAGAACGAACTGCAGAACGACCTGGAGAAGGCGGTCGAGTTCGACCAGAGCGCACTG
TTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGACACCCCTTCAGCCTGCTGATCGGCGACT
TCACCTTCGGTCGCCATCCGCAGGACATCGGCCTGCTGGAGAAGCTGTCGAACGTCGCCGCGGCTGCCCA
CGCGCCGTTCATCGCCGCCGCCAGCCCACGCCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTGCCG
CGCGACCTGACCAAGATCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGACT
CGCGCTACGTGTCGCTGGTGCTGCCGAACTTCCTCCTGCGCCTGCCCTACGGCCCGGAGACGCGACCGGT
GGAAGGCATGAACTATGTCGAGGACGTCAACGGCACCGACCACTCCAAGTACCTCTGGGGCAACGCCGCC
TGGGTCCTGGCGCAGCGCATCACCGAGGCCTTCGCCAAGTACGGCTGGTGCGCGGCGATCCGCGGCGCGG
AAGGCGGCGGCGCGGTCGAGGGCCTGCCGGCGCACACGTTCCGCACCAGCTCCGGCGACCTGTCGCTGAA
GTGCCCGACCGAGGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGATCTCGGCTTCATTTCCCTG
TGCCACAAGAAGAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAGGCTCTACA
ACACCAACGAGGCCAACGCCAACGCGCGCCTGTCGGCGATGCTGCCGTACGTGCTGGCGGCATCGCGCTT
CGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTGAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCACCGCAGGAAATCAAGGCGCAGT
ACCCGCTGCGCGAGGCGCGGGTGGATGTCAGCGAGGTGGCCGGCAAACCGGGAGCCTACCGCGCCACGGT
GTTCCTCCGGCCGCACTTCCAGCTCGAGGAACTCAGCGCGTCGATCCGCCTGGTCGCCAACCTGCCGCCG
CCGGTAGCGGCGTGA