SecReT6
Protein ID: 568309692
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2953
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3137390..3137935 [-]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDV9U3T4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-52, Aligned region: 9..161
Protein Sequence: 181 a.a.     [Download]
>gi|568309692|ref|YP_008981961.1| Uncharacterized protein ImpB [Pseudomonas aeruginosa SCV20265]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNE
ILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDD
LDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3137935-3137390 Pseudomonas aeruginosa SCV20265, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCG
AGATCGGCAACGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGATACCCCGCCGGCGAAGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAG
ATCCTCTCCTCCATCTCTCCCCGCGCCACCCTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGC
TGAACGTCGAGCTGCGCTTCAACCACATCGAGGACTTCGACCCGGTCAACCTGGTGAAGCAGGTGGTCCC
GTTGCGTCGCCTGTTCGAGGCGCGCCAGCGCCTGCGCGACCTGCTGACCAAGCTCGACGGCAACGACGAC
CTCGACCAGTTACTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCGGCCCGCCCGG
AAGCCGAAGCGGCCCCGGCCGGCGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA