SecReT6
Protein ID: 568309696
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2957
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3140029..3140787 [+]
ProductInner membrane protein DotU
NoteTssL
UniProt IDV9U2I1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|568309696|ref|YP_008981965.1| Inner membrane protein DotU [Pseudomonas aeruginosa SCV20265]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|568306739|ref|NC_023149.1|:3140029-3140787 Pseudomonas aeruginosa SCV20265, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAACCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGGGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGCTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCCGCCGCTGCGCCGCCACGGCGTCTGCCGGTGCGCGCAGCGCTGCCGGACGGT
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCATGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA