SecReT6
Protein ID: 568309698
SecReT6 ID894
T6SS typei4a
Gene symbol-
Locus tagSCV20265_2959
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3144596..3145696 [+]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDV9U550
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 249..259
Protein Sequence: 366 a.a.     [Download]
>gi|568309698|ref|YP_008981967.1| Uncharacterized protein ImpA [Pseudomonas aeruginosa SCV20265]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLLRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADASEG
DADGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|568306739|ref|NC_023149.1|:3144596-3145696 Pseudomonas aeruginosa SCV20265, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAAGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTAGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTACTGCGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCATTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGTCCGAAGAACAGCCCCCGGTCGCGGAGGCGGATGCCAGCGAAGGC
GACGCGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGGCCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTACCGGCAATTGCTGCTGATCGCTGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAGTGGGGCAACAAGCCGCTGAGCGAGTTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGAGTCTGGTCGCTGCTTGGCGTACTGCCCTAA